KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0550100-01Help
Entry
Os01t0550100-01   CDS       T02163                                 

Gene name
Os01g0550100
Definition
Similar to Ubiquitin-specific protease 6.
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(20589445..20589454,20587459..20587604,20587319..20587354,20587099..20587206,20586105..20586205,20585898..20586024,20584854..20584913,20584702..20584766,20584480..20584533,20583898..20584006,20583634..20583723,20583486..20583554,20582879..20582959,20582723..20582797,20582525..20582573,20582207..20582326,20582052..20582126,20581921..20581970))
AA seq 474 aa AA seqDB search
MPTVSVKWQKETFPGIEIDTSQPPVVFKTQLYTLTGVPPERQKIMVKGGILKDDADWSTL
GVKDGQKLMMIGTADEIVKAPEKGPVFVEDLPEEEQVVALGHSAGLYNLGNTCYMNSTLQ
CLHSVPELKSALLSYSDNVRGNGVDQASHNLTVATRNTFGELDQSVRPVAPLLFLQTLRK
KYPQFAQQQNNVYMQQDAEECWTQLVYTLSQTLTSETSEPPAGQMKELFGIDLVSRVHCA
ESGEESLERESVYSLKCHISHDVNHLHEGLKHGLKSELEKASPSLGRTALYTRESRINEL
PRYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQMLRDAENA
KFGLKAQGKASSSKENEGSSSNAGESSSMDIDKADSSVPKKHLTGIYDLIAVLTHKGRSA
DSGHYVGWVKQDDGKWIEFDDDNPSIRKEEEILKLSGGGDWHMAYICLYKARVI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtaagcgtgaaatggcagaaggagaccttcccaggcatagagatagacacc
agccagccgcctgttgtctttaagacccagctatacactctgactggtgtaccacctgaa
aggcaaaaaattatggtgaagggtggaatattgaaggatgatgcagattggtctactttg
ggagtgaaagatggtcaaaaattgatgatgataggtacagctgatgagattgtgaaagct
ccagagaaaggaccagtatttgtagaggatctaccagaagaagagcaagtggttgcactg
ggacacagtgctggtctttataacttggggaatacatgttacatgaattccactttgcag
tgcctgcattctgttccagagctgaagtcagctttattgagttattcagataatgtgagg
ggtaatggtgttgaccaagcctcccataatttgactgttgcaactcgtaatactttcgga
gagcttgatcaaagtgttcggcctgttgcacctctactcttcttacagacgctgcgtaaa
aagtatccccagtttgcgcaacaacaaaataatgtttatatgcaacaggatgcagaagaa
tgctggacccaattggtgtatacactttctcaaactcttacatcagaaacaagtgaacct
cctgctggtcaaatgaaggaactttttgggattgatctcgtgagcagggtccattgtgca
gaaagtggtgaagagagtttagagagagaatcagtttattctttgaagtgtcatatatct
catgatgtaaaccaccttcatgaaggacttaagcatggtttgaagtcagaacttgagaag
gcttcaccttcactgggtcgcactgctctttatacaagagagtcaagaataaatgagttg
cctaggtacttgactgtgcagtttgttcgtttcttttggaaaagggaatcaaaccagaag
gcaaagattttacggaaagttgattacccgctggaactggatgtttatgacttttgctca
gatgaactgaaacaaaaactccaagctccccgacagatgctgagagatgcagaaaatgct
aagtttggattaaaagcacaaggaaaggccagcagctcaaaagaaaatgagggttcatca
agcaatgctggggaatcatccagcatggatattgacaaagccgattcttctgtgccaaag
aaacatttgactggcatctatgatttaattgctgttttgacgcacaaagggagaagtgca
gactcaggccattatgttggctgggttaagcaagatgacgggaaatggattgaatttgat
gatgacaaccctagcatacgcaaggaggaagagattttaaagttatctggtggaggcgac
tggcacatggcttacatttgcctgtacaaagctcgtgttatctga

DBGET integrated database retrieval system