KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0598200-01Help
Entry
Os01t0598200-01   CDS       T02163                                 

Gene name
Os01g0598200, CBL5, CALCINEURIN_B-LIKE_PROTEIN_5
Definition
Similar to Calcineurin B-like protein 8.
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Os01t0598200-01 (Os01g0598200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr01:join(23499684..23499774,23500191..23500273,23500357..23500413,23500893..23501001,23501119..23501171,23501533..23501613,23501704..23501816,23502093..23502162)
AA seq 218 aa AA seqDB search
MMGCLPTKQVGRSTHSLNPREAVALAAETSFTVNEVEALYDLFRKLSNSIIKDGLIHKEE
FHLALFRNKKTNLFVDRVFDLFDQKGNGVIEFDEFVRSLSVFHPDAPEEQKAGFAFKLYD
LRQTGFIERHELKEMVLALLDESDLNITSDAVEMIVDRTFDQADTKGDERIDQEEWNEFV
KNNPYVLRNMTLPYLKDLTMVFPSFVIHSEVSEADMVA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgggctgtctaccaacaaagcaagtgggtcgttcaacacattccttgaatccacgg
gaagctgtggctcttgcggctgaaacatcttttactgtgaatgaagttgaggcattatac
gatctcttcaggaaattaagtaattcaataattaaagatggtctgattcacaaggaagaa
ttccatcttgctctctttaggaacaagaagacaaatctcttcgttgatagggtctttgat
ttgtttgatcaaaaaggaaatggtgtcatcgaatttgatgaatttgttcgatctcttagt
gtgtttcatccagatgcacctgaggaacagaaagctggatttgcatttaagttatatgac
ctaagacagacagggtttattgaaaggcatgagttaaaggagatggtgttggctcttctg
gatgaatcagatttgaatattacaagtgatgctgtcgagatgattgttgataggacattt
gaccaggctgacacaaaaggcgatgagagaatagaccaggaggagtggaatgagtttgtc
aaaaataatccatatgtgctgaggaatatgaccctcccatacctcaaggacctcaccatg
gtattcccaagttttgtgattcactcagaagtcagcgaagcagacatggttgcctaa

DBGET integrated database retrieval system