KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0633500-00Help
Entry
Os01t0633500-00   CDS       T02163                                 

Gene name
Os01g0633500
Definition
Similar to Dihydroflavonol reductase.
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os01t0633500-00 (Os01g0633500)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Os01t0633500-00 (Os01g0633500)
    1.1.1.234  flavanone 4-reductase
     Os01t0633500-00 (Os01g0633500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(25383095..25383415,25383803..25384435)
AA seq 317 aa AA seqDB search
KERLTLWKADLGEEGSFDAAIRGCTGVFHVATPMDFESEDPENEVVKPTVEGMLSIMRAC
RDAGTVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMTGWMYFVSKSLAEKAA
MEYAREHGLDLISVIPTLVVGPFISNGMPPSHVTALALLTGNEAHYSILKQVQFVHLDDL
CDAEIFLFESPEARGRYVCSSHDATIHGLATMLADMFPEYDVPRSFPGIDADHLQPVHFS
SWKLLAHGFRFRYTLEDMFEAAVRTCREKGLLPPLPPPPTTAVAGGDGSAGVAGEKEPIL
GRGTGTAVGAETEALVK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
aaggagaggctgacgctgtggaaggccgacctgggcgaggaaggcagcttcgacgcggcg
atcaggggttgcacgggcgtgttccacgtcgcgacgcccatggacttcgagtccgaggac
ccggagaacgaggtggtcaagcccaccgtggaagggatgctgagcatcatgcgggcctgc
agggacgccggcaccgtcaagcgcatcgtcttcacctcctccgccgggaccgtcaacatc
gaggagcggcagcgcccctcctacgaccacgacgactggagcgacatcgacttctgccgc
cgcgtcaagatgaccggatggatgtacttcgtgtccaagtcattggcggagaaggccgcc
atggaatacgcgagggagcacgggctggacctcatcagcgtcatccccacgctcgtcgtc
gggcccttcatcagcaacgggatgccgccgagccacgtcaccgcgctggcgctgctcacg
gggaacgaggcccactactcgatcctgaagcaggtgcagttcgtccacctcgacgacctc
tgcgacgccgagatcttcctcttcgagagccccgaggcgcgcggccgctacgtctgctcc
tcccacgacgccaccatccacggcctcgcgacgatgctcgcggacatgttcccggagtac
gacgtgccgcggagctttcccgggatcgacgccgaccacctccagccggtgcacttctcg
tcgtggaagctcctcgcccacgggttcaggttcaggtacacgctggaggacatgttcgag
gccgccgtccggacgtgcagggagaaggggcttctcccgccgctgccgccaccgccgacg
acggccgtggccggaggagacggctcggcgggtgtggccggcgagaaggaaccgatactg
gggagggggaccgggacggcggttggtgctgaaacagaagcgttggtcaaatga

DBGET integrated database retrieval system