KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0634600-00Help
Entry
Os01t0634600-00   CDS       T02163                                 

Gene name
Os01g0634600
Definition
Pectin lyase fold/virulence factor domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os01t0634600-00 (Os01g0634600)
   00500 Starch and sucrose metabolism
    Os01t0634600-00 (Os01g0634600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os01t0634600-00 (Os01g0634600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(25443912..25444157,25443660..25443809,25443317..25443505,25442863..25443110,25442602..25442746))
AA seq 325 aa AA seqDB search
MPMPLYGVVNSPCRSHCRAAATLLVSVSLLCSCFAIAMPSVVVTVDQSGKGDHRRIQDAI
DAAPANDSSRTVIRIKPGVYRRKVVVDKPYVTLTGTSATSTVIAWNESWVSDESPTVSVL
ASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAAFYGCRFVSFQDTLLDETGRHYYRGCYVQ
GATDFIFGNGRALFDKCHLHSTSPDGAGGAFTAQQRSSESEETGYSFVGCKLTGLGAGTS
ILGRPWGPYSRVVFALTYMSSTVRPQGWDDWGDPSNQRTAFYGQYQCYGDGSKTDGRVAW
SHDLTQAEAAPFITKAWVDGQQWLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgccgttatatggggtggtcaactcgccgtgccgcagccactgcagggccgcg
gcaacgttgttggtctcggtgtccctgctctgctcttgcttcgccatcgccatgccgagc
gtcgtcgtcacggtcgaccagtccggcaagggcgaccaccggaggatccaggacgcgatc
gatgccgccccggcaaacgactcctcccgcaccgtcatccggatcaagcccggggtttac
aggcgaaaggtcgtggtggacaagccgtacgtgacgctgaccggcacgagcgcgacctcg
acggtgatcgcctggaacgagtcgtgggtctccgacgagtcccccaccgtgtccgtgctg
gcctccgacttcgtcgccaagcgcctgacgtttcagaacacgttcggggacagcgcgccg
gcggtggcggtgagggtcgccggagacagggcggcgttctacgggtgcaggttcgtgtcg
ttccaggacacgctcctcgacgagacggggcggcactactaccgcggctgctacgtgcag
ggcgccaccgacttcatattcggaaacggccgggctctgtttgacaaatgccacctgcac
tccacgtcgcccgacggcgccggcggggcgttcacggcgcagcagcggtcgtcggaatcg
gaggagacggggtacagcttcgtggggtgcaagctgaccggcctcggcgccggcacctcc
atcctgggccggccgtgggggccatactcccgcgtcgtcttcgcgctcacctacatgtcc
tccaccgtcaggccccaaggctgggacgactggggcgacccctccaatcagcggacggcg
ttctatgggcagtaccagtgctacggcgacggatcgaagaccgacggcagggttgcctgg
tctcacgacctgacgcaggccgaggcggcgccgttcatcaccaaggcttgggttgatggg
cagcaatggcttcggtag

DBGET integrated database retrieval system