KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0635400-01Help
Entry
Os01t0635400-01   CDS       T02163                                 

Gene name
Os01g0635400
Definition
Similar to mRNA-associated protein mrnp 41 (Rae1 protein homolog).
Orthology
K14298  
mRNA export factor
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os01t0635400-01 (Os01g0635400)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Os01t0635400-01 (Os01g0635400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:join(25466460..25466519,25466641..25466727,25466851..25466919,25467035..25467228,25467521..25467662,25468403..25468483,25469260..25469388,25469700..25469777,25472393..25472464,25473536..25473616,25473897..25473938)
AA seq 344 aa AA seqDB search
MASFTAGGGGANNNPNKSLEVNPAPGDSVSSLSFSPKANHLVATSWDNQVRCWEIQPGGQ
CQAKASISHDQPVLCSAWKDDGTTVFSGGCDKQIKMWPLLSGGQPMVLSGHEAPVKELAW
IPQMNLLVSGSWDKTLRYWDVRQPQPAHVQQLPERCYALSLSYPLMVVGTADRNVIVFNM
QNPQAEFKRIVSPLKLQTRCLAAFPDQQGFLVGSIEGRVGVHHVDDGQQGKNFTFKCHRD
GNDIYAVNALNFHPVHHTFATSGSDGGFNFWDKDSKQRLKAFNKCPSPITCSTFNQDGSI
FAYAVCYDWSKGAEKHNPSTAKTNIFLHSVQESEVKGKPRVNKK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctttaccgccggcggcggcggcgccaacaacaaccccaacaagtccctcgag
gtgaatccggcgcccggggactcggtttccagcctcagcttcagtcccaaggcgaaccac
ctcgtcgccacatcatgggacaaccaggttcgttgctgggagatccagcctggaggccaa
tgccaagcgaaggcctcgatctcgcacgatcagccggtgctgtgctcggcatggaaggat
gatgggactactgttttttcgggaggttgtgataaacagattaagatgtggccgctgctc
tccggtgggcagcccatggttttatcagggcatgaagcaccggtcaaagagcttgcctgg
ataccacagatgaaccttcttgttagtgggagctgggacaagactctgaggtactgggat
gttcgacaacctcagccagcacatgttcagcaactacctgagcgctgttatgctctctca
cttagttatcctctcatggtggttggcactgctgatcgaaatgtaatagtcttcaatatg
cagaatccacaggctgaattcaagaggattgtgtcacctttaaaactccagacaaggtgt
cttgctgcatttcctgatcagcaagggtttctggttggatcgatagaaggacgagttggt
gttcatcatgttgatgatggtcaacaagggaaaaactttacatttaaatgtcaccgtgat
ggcaatgacatatacgctgttaacgcattgaactttcaccctgtgcaccatacttttgcc
acttcgggctctgatggaggtttcaacttttgggacaaggacagtaagcaaaggcttaag
gctttcaataagtgtccgtcacccatcacatgcagtacattcaatcaggatggctcaata
tttgcttatgcggtatgctatgattggagcaagggtgccgagaagcacaatccttctact
gcaaaaacaaatatctttctccatagtgtccaggaatctgaggtcaaaggaaagccccgt
gttaataagaagtag

DBGET integrated database retrieval system