KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0658700-01Help
Entry
Os01t0658700-01   CDS       T02163                                 

Gene name
Os01g0658700
Definition
Glycoside hydrolase-type carbohydrate-binding, subgroup domain containing protein.
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(26795152..26795259,26794943..26795017,26794284..26794340,26793976..26794139,26793153..26793287,26792732..26792834,26792363..26792462,26792028..26792230))
AA seq 314 aa AA seqDB search
MSMGHYSEQRPGFEVTKDWNGADQVMIRSPRGASVLVSLHGGQVVSWRNDRGEELLFTSS
KAIFKPPKAMRGGIPICFPQFGNCGTLEQHGFARNRLWAIDDEAPPLNHNDNNGKVSVDL
LLKPSEDDLKCWPHCFEFRLRVSLSTDGDLSLVSRVRNVNGKPFSFSFAYHTYLSVSDIS
EVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGSPSVIAVLDHEKKRTFIVR
KEGLPDVVVWNPWDKKSKTMADFGDEEYKQMLCVDAAAVERAITLKPGEEWTGKLELSAV
ASTNCSDHLDYPCS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggggcattactccgagcagaggccggggttcgaggtgaccaaggactggaac
ggcgccgaccaggtcatgatccggtcgccgcggggggcgtccgtcctggtcagcctgcac
ggcgggcaggtcgtctcctggaggaacgaccgcggcgaggagctcctcttcaccagcagc
aaggctatcttcaagccaccaaaagcgatgcgaggtggaattcccatatgctttccacag
tttggaaattgtggaacattggagcagcatggatttgcaaggaacaggctatgggccata
gatgatgaggctccaccactaaatcataatgataacaacggcaaagtttctgttgacctt
ctgttaaagccatctgaagatgatctcaaatgttggccacactgctttgaattccgtctc
agagtttctctttcgacggatggagatctctcgttagtatcacgagtcaggaatgttaat
gggaagccattcagtttttcgtttgcttaccatacatatctttcagtctctgacatcagt
gaggtgagaatagaaggtctggagacacttgattatcttgacaaccttagccaaagagaa
cgttttacagaacaaggagatgctataacatttgagtctgaggttgacagagtctacgtt
ggttccccaagcgtaattgctgtgcttgaccatgagaagaaacgcaccttcattgtaagg
aaagaagggcttcctgacgtcgttgtttggaacccatgggacaagaagtcgaaaacgatg
gcggattttggcgacgaggagtacaagcagatgctgtgtgtggacgctgccgcagtcgag
cgagccatcacgctgaagccaggcgaggagtggacggggaagctggagctgtccgccgtc
gcttccaccaactgcagcgaccatctggactacccttgtagctag

DBGET integrated database retrieval system