KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0665400-01Help
Entry
Os01t0665400-01   CDS       T02163                                 

Gene name
Os01g0665400
Definition
Ribokinase family protein.
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Os01t0665400-01 (Os01g0665400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Os01t0665400-01 (Os01g0665400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(27185694..27186314,27188373..27188558,27190065..27190260,27190365..27190465)
AA seq 367 aa AA seqDB search
MPTLDARLRLPLAGLSPATTSFPGSTPKPGSLSFALRPPSASLSSSASAPAAAAPPIVVV
GSANADIYVEVDRLPLVGETVAARAGRSLAGGKGANQAACGGRLAAGPTYLVARVGDDAN
GRLLEGALADAGGVRLDRVARAPGAPSGHAVVMLMPGGQNSIIIVGGANMEGWASGVGSD
DLDLIRRAGVLLLQREIPDWVNVQVAQAAKGAGVPVILDAGGMDAPVPGELLSLVDIFSP
NETELARLTGMPTETFEQISRAAGACHKMGVKEVLVKLGSQGSALFIEGGEPIRQPIIPA
TEVVDTTGAGDTFTSAFAVALVEGKPKEECMRFAAAAASLCVQVKGAIPSMPDRKSVMDL
LESVQVE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctactctcgacgctcgcctccgcctccctctcgccggactatcgccggcgacgacc
tccttcccgggatccacccccaagccgggcagcctctcgttcgccctcaggccgccctcc
gcctccctgtcatcctccgccagtgccccggcggcggcggcgccgcccatcgtcgtcgtg
ggctccgccaacgccgacatctacgtcgaggtcgaccgcctcccgctcgtcggggagacg
gtggcggcgcgcgccggccgcagcctcgcgggcgggaagggcgccaaccaggccgcctgc
gggggccgcctcgcggcggggcccacctacctcgtggcgcgcgtcggggacgacgccaac
gggcggctcctcgagggcgccctcgcggacgccggcggcgtccgcctagaccgcgtcgcg
cgcgcgcccggcgcgccctcgggccacgccgtggtgatgctgatgcccggcgggcagaac
tccatcatcatcgtcggcggcgccaacatggaggggtgggcctcgggggtcggctcggac
gacctggacctgatccgccgggctggcgtgctgctgctgcagcgggagatacccgattgg
gtcaacgtgcaggttgcgcaggcagcaaaaggtgcaggtgtgcctgttatcttggacgcc
ggtggaatggatgctcctgtccctggggaactactgagcctggtggatatttttagtcca
aatgaaacagagcttgcacgtttgactgggatgcctacagaaacatttgaacagatcagt
cgagctgcaggagcatgccataaaatgggtgtgaaagaagtgctggttaaactcggatca
caaggatctgctttatttattgaagggggggagccgatcaggcagccgataattcctgcc
acagaagttgttgatacgactggtgccggtgacactttcacctcagcttttgctgtagct
ctagttgagggtaaacctaaggaagagtgcatgagatttgctgctgctgctgcatctcta
tgtgttcaagtaaagggagccatacccagcatgcctgaccgaaaatcagtaatggacctt
ctggaatctgttcaggttgaataa

DBGET integrated database retrieval system