KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0693800-01Help
Entry
Os01t0693800-01   CDS       T02163                                 

Gene name
Os01g0693800
Definition
Similar to Threonine synthase, chloroplast precursor (EC 4.2.3.1) (TS).
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os01t0693800-01 (Os01g0693800)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os01t0693800-01 (Os01g0693800)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Os01t0693800-01 (Os01g0693800)
Enzymes [BR:dosa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Os01t0693800-01 (Os01g0693800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:complement(28654300..28655877)
AA seq 525 aa AA seqDB search
MATATASSLSLLFAHPHSSNPRPFAGGPHLRRPLRAAPHRARCASDAATTATRHRRPAEE
NIREEAARLRGPGNDFSAWYVPFPPTPEDDPDERYSLDEVVYRSSSGGLLDVCHDMEALA
RFPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLFWAERLGR
EHLGGMTDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPINGVGCASTGDTSAA
LSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIY
LANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDR
VPRLVCAQAANANPLYRFYKSGWTDFQPRVAETTFASAIQIGDPVSVDRAVVALKATDGI
VEEATEEELMDAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKF
TQSKIDYHDRNIKDMLCQYANPPINVKADFASVMDVLQNKLNGKI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccaccgcgtcgtccctctctctcctcttcgcccacccacactcgtccaac
cccaggcccttcgccggcgggcctcacctccgccgcccgctgcgcgccgcgccccaccgc
gcgcgatgcgcctccgacgccgccacgacggccacgaggcaccgccgccccgcggaggag
aacatccgggaggaggccgcgcggctccgcggccccgggaacgacttctcggcgtggtac
gtgccgttccccccgacgcccgaggacgaccccgacgagcgctactcgctggacgaggtg
gtctaccgctccagctccggggggctcctcgacgtgtgccacgacatggaggcgctcgcg
cgcttcccgggctcctactggcgcgacctcttcgactcccgcgtggggcgcaccgcgtgg
ccctacggctccggggtgtggtccaagaaggagttcgtgctcccggagatcgactccgac
cacatcgtctccctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgc
gagcacctcggcgggatgaccgacctctgggttaagcactgcggcatctcgcacacgggc
tccttcaaggacctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcg
ccgctctcacgccccatcaacggcgtcggctgcgcgtccacgggcgacacctccgccgcg
ctttccgcgtactgcgccgccgcaggtatccccgccatcgtgttcctccccgccgaccgc
atctctctgcagcagctcatccagccaatcgccaacggcgccaccgtgctctcgctggac
acggactttgacgggtgcatgcggctcatcagggaggtgaccgccgagctaccgatttac
cttgccaactcgctgaactcccttcggcttgagggccagaagacggcagccatcgagata
ttgcagcagttcgattggcaggtgccggattgggtcattgttccaggaggcaatcttggg
aatatctatgccttctacaaggggtttgagatgtgccgtgttcttgggcttgttgatcgt
gtgccgcgtcttgtatgcgcacaagctgcaaacgcaaatccgttgtatcggttctacaag
tcagggtggactgatttccagccacgtgtagccgaaactacatttgcatctgccatacag
attggtgatccagtatctgtcgaccgtgcagtggtcgccctgaaggcaactgacggtatt
gttgaggaagctacggaggaagaactcatggatgcaatgtcacttgctgaccgcaccgga
atgtttgcctgcccacacaccggggttgcacttgctgctttgttcaagcttcgagaccag
cgcataatcgggcctaatgaccgcacagtggttgttagtacagcgcatgggcttaagttc
acacaatcgaagatagactaccatgacaggaacatcaaggacatgctgtgccagtacgct
aatccaccaatcaatgtgaaggctgactttgcttctgtgatggatgttctccagaacaag
ctgaatggtaagatctga

DBGET integrated database retrieval system