KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0717000-01Help
Entry
Os01t0717000-01   CDS       T02163                                 

Gene name
Os01g0717000
Definition
Similar to GmCK1p (EC 2.7.1.32).
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os01t0717000-01 (Os01g0717000)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Os01t0717000-01 (Os01g0717000)
    2.7.1.82  ethanolamine kinase
     Os01t0717000-01 (Os01g0717000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(29846152..29846574,29844832..29844953,29844555..29844750,29843931..29844048,29843777..29843824,29843495..29843598,29843288..29843383))
AA seq 368 aa AA seqDB search
MVAIENQSQGQRAAEAAAQPRIPREARRLLHEMAASWADVADCRALQVIPLKGAMTNEVY
QVRWLNGAPATADGGEVEAEAAAREREVRKVLVRIYGDGVELFFDREDEVRTFECMSRHG
QGPRLLGRFTNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIWDR
LKNWLKTARNLCSSDESKKFRLGSLENEIAALEKEFSGDYHGIGFCHNDLQYGNIMIDED
TNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYLS
NSVSEEPDAEEVENLLQSIEKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQ
KKQALLTS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagagccagggccagcgggcggcggaggcggcggcgcagcca
cggatccccagggaggcgcggcggctactgcacgagatggcggcgtcgtgggcggacgtt
gccgactgccgggcgctgcaggtgattccgctcaagggcgccatgaccaacgaggtgtac
caggtgcgctggctcaacggcgccccggccaccgccgacggcggcgaggtggaggcggag
gcggccgcaagggagagggaggtgaggaaggtcctcgtgcggatatacggcgacggcgtg
gagctcttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtctcgccatggc
caaggcccccgcctcctcggccggttcaccaacggccgcgtcgaggagttcatccacgca
aggacactatctgcagcagaccttcgtgatcctgaaatttcagctctggtggcgtcaaaa
ctgagggaattccacaaccttgacatgcctggcccgaaatctgtactcatttgggaccga
ctgaaaaactggctcaaaactgcaaggaacctgtgctcatctgatgaatccaagaaattt
cggctgggtagcctggagaacgagattgctgcattggagaaagaattttcaggggattac
cacgggattggtttttgccacaacgatcttcagtatggcaacatcatgattgatgaagac
accaacatgttgactatcatcgattatgaatatgccagcttcaatccagttgcgtatgac
atcgctaatcatttctgcgagatggcagcagactatcattcagagaagccacatagactg
gactacagtaaatatccagacactgatgagcagaagcgttttgtgaagacgtacctaagc
aattctgtaagtgaagaacctgatgcggaagaggtggagaaccttctccaaagcattgag
aaatacacgctcgccagtcatctagtttggggcctctggggaataatatcggatcatgtc
aatgatattgacttcgactacaaggagtatgcaaggcagagattcgagcagtattggcag
aagaagcaagcacttttaacttcatga

DBGET integrated database retrieval system