KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0743200-01Help
Entry
Os01t0743200-01   CDS       T02163                                 

Gene name
Os01g0743200
Definition
Pectin lyase fold/virulence factor domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os01t0743200-01 (Os01g0743200)
   00500 Starch and sucrose metabolism
    Os01t0743200-01 (Os01g0743200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os01t0743200-01 (Os01g0743200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(31058024..31058394,31057747..31057939,31057462..31057668,31056372..31056607,31055729..31055876))
AA seq 384 aa AA seqDB search
MAVAPVRLVACIVALAAVAPGGVAGHTRGVRPGRAAGKQQPSFPENATRVEAIERQFMEW
VRYMGGLEHSTVHHALARAFPSYSLVVDKNPAFGDFTTIQAAVDSLPIINLVRVVIKVNA
GTYTEKVNISPMRAFITLEGAGADKTIVQWGDTADSPSGRAGRPLGTYSSASFAVNAQYF
LARNITFKNTSPVPKPGASGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKECY
IEGSVDFIFGNALSLFEDCHVHAIARDYGALTAQNRQSMLEDTGFSFVNCRVTGSGALYL
GRAWGTFSRVVFAYTYMDDIIIPRGWYNWGDPNRELTVFYGQYKCTGPGASFSGRVSWSR
ELTDEEAKPFISLTFIDGTEWVRL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggcgcccgtccggctcgtggcgtgcattgtcgccctggccgccgtggcgccg
ggcggagtggcggggcacacacggggcgtgcggccagggagggcggcggggaagcagcag
ccgtcgttcccggagaacgcgacgcgggtggaggcgatcgagcggcagttcatggagtgg
gtacggtacatgggcgggctggagcacagcacggtccaccacgcgctcgcccgggcgttc
ccctcctactcgctcgtcgtcgacaagaacccggcgttcggcgacttcaccaccatccag
gccgccgtcgactcgctcccgatcatcaacctcgtccgcgtcgtcatcaaggtcaacgcc
ggcacctacacggagaaggtgaacatatcgccgatgcgcgcgttcatcaccctcgagggc
gccggcgccgacaagacgatcgtgcagtggggtgacaccgcggacagtccgtccggccgg
gcgggacggccgctcggcacatacagctccgcgtcgttcgccgtgaacgcgcagtacttc
ctcgccaggaacatcactttcaagaacacgtcgccggtgccgaagccgggggcgtcgggg
aagcaggcggtggcgctgcgggtgtcggcggacaacgcggcgttcgtggggtgcaggttc
ctgggcgcgcaggacacgctgtacgatcactcgggccggcactactacaaggaatgctac
atcgaaggctccgtggatttcatctttggcaatgcgctctctctgtttgaggattgccac
gtgcatgcgatcgcgcgggactacggcgcgctgacagcgcagaaccggcagagcatgctg
gaggacacggggttctcgttcgtcaactgccgggtgacgggatccggcgcgctctacctc
ggccgcgcctggggcaccttctcccgcgtcgtcttcgcctacacctacatggacgacatc
atcatcccccgtggctggtacaactggggcgaccccaaccgcgagctgacggtgttctac
gggcagtacaagtgcacgggccccggcgcgagcttctccggcagggtgtcgtggtcacgc
gagctcaccgacgaggaggccaagcccttcatctcgctcaccttcatcgacggcacggaa
tgggtcaggttgtga

DBGET integrated database retrieval system