KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0752200-01Help
Entry
Os01t0752200-01   CDS       T02163                                 

Gene name
Os01g0752200
Definition
Crotonase, core domain containing protein.
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os01t0752200-01 (Os01g0752200)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Os01t0752200-01 (Os01g0752200)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Os01t0752200-01 (Os01g0752200)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os01t0752200-01 (Os01g0752200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Os01t0752200-01 (Os01g0752200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:complement(join(31556635..31556679,31556454..31556537,31556288..31556356,31555777..31555837,31555562..31555635,31555384..31555467,31554991..31555075,31554705..31554790,31554428..31554549,31554264..31554324,31553890..31553988,31553537..31553638,31553395..31553436,31553210..31553316,31553055..31553103))
AA seq 389 aa AA seqDB search
MAEPEQQQQQANPDEVVLGQETGGARVAILNRPRQLNVISDRVVYLLAQFLESWEKDEDA
KLVIFKGAGRAFSAGGDLKMFYEGKSDDSCLEVVYRMYWLCYHIHTYKKTAVALVNGLVM
GGGAAMVAPLKFAVVTEKTVFATPEASVGLHTDCSFSYIHSRLPGYLGEYLALTGARLNA
KEMIAAGLATHFVPSEKLEELEKCLLNLNTGDESAVRAAIEEFSTDVQPDEDSILNKLPT
INKCFSAETIEDIIKAFESEGSIDGNQWIATVLKGMRRSSPTSLKMTLRSIREGRKQSLP
ECLKKEFRLTMNTLRSVVTGDVYEGIRALSIDKDNAPKWSPATLEEVKNEDIDRLFEPFS
SEKELQVPSDDSNRWSGKFEHTVYGRTSE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccggagcagcagcagcagcaggcgaatcccgacgaggtggtgctcgggcag
gagaccggcggcgcgagggtggcgatcctcaaccggccgcgccagctgaacgtcatctcc
gatagagtggtgtatctcctcgcccagttcttggagagctgggagaaagatgaggatgcc
aagctggtcatcttcaagggggctggacgtgcattttccgctggtggggatctaaagatg
ttctatgaaggaaaatcagatgactcctgtctcgaggttgtttacaggatgtattggctt
tgctaccatatccacacgtataagaaaaccgcggtggctcttgttaatggacttgtcatg
ggtggtggtgcagccatggttgctccactgaagtttgcagttgtcacagagaaaacagtc
ttcgcaacccctgaggctagtgttggattacacacagactgcagcttttcttatatccat
tctagactccctggatatttaggggagtacctggctttgaccggtgcaaggttgaatgca
aaggaaatgattgctgccggtcttgctactcattttgttccttctgaaaaattggaagaa
cttgaaaaatgcctgctgaatttaaacacaggagatgagtctgctgttcgagctgctatt
gaagagttctcaactgatgttcaacctgatgaagatagtattttaaacaagctcccaact
atcaacaaatgtttctctgctgagactatcgaggacatcataaaagcttttgaatcagaa
gggagcattgatggaaaccaatggatcgctacagtactgaagggcatgcgaagatcatct
cctacttcactgaagatgactcttcgatcgatcagagaaggtcggaagcagagcctgccg
gaatgtttgaagaaggaattccgacttacaatgaacactctccgatctgtagttactggc
gatgtctatgagggaattagagctctcagcatcgacaaagacaatgcccctaagtggagt
cctgctacccttgaggaggtcaagaacgaggacatcgaccgtcttttcgaaccattcagt
tcagaaaaggagctccaagtcccatctgacgattccaacagatggagtggcaaatttgag
cacacagtctatggcagaacttcagagtaa

DBGET integrated database retrieval system