KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0771400-00Help
Entry
Os01t0771400-00   CDS       T02163                                 

Gene name
Os01g0771400
Definition
Similar to CM0545.290.nc protein.
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os01t0771400-00 (Os01g0771400)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os01t0771400-00 (Os01g0771400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(32569258..32569462,32568410..32568539,32568170..32568327,32567131..32567396,32566840..32567058,32566656..32566764,32566442..32566557,32565726..32565824,32564746..32564855,32563965..32564039,32562854..32562932,32562623..32562769,32562471..32562551,32562269..32562388,32560999..32561121,32559140..32559217,32558918..32559006,32558702..32558810,32558539..32558607,32558320..32558430,32556613..32556668,32556330..32556507,32556145..32556246,32555834..32556067))
AA seq 1020 aa AA seqDB search
MVVRFEMVSIRVWVFFFTEMRWRFTKVWVLVACPVVCSSCSRTRMRRCWCQTRMLLLRDL
SRWKVRFLYSGSTVENEQVPETSTSRFTWTIEDFSNHRKLYSDVFVVGGHKWRVLVFPTG
NSVQSLSMYLDIADANEQPHGWSKYAQFSLAVINQLDSKYSLRKEAAHHFSTRESDWGFT
SFMHLGDLYDPTKGYIVNDKCIIEAEVAVRKIVDFWNYDSKKETGYVGLKNQGATCYMNS
LLQTLYHIPYFRKAVYHMPTTENDTPCGSIPLALQSLFCKLQHSDNSVSTKELTKSFGWD
TVDSFLQHDVQELNRVLCEKLENKMKGTTVEGTIQQLFEGHHMNYIECINVDYKSTRKES
FYDLALDVKGCSDVYASFDKYVEVERLEGDNKYQSEKHGLQDAKKGMLFIDFPPVLQVQL
KRFEYDFVRDTMVKINDRYEFPLQLDLDKDDGKYLSPEADRRVRNLYTLHSVLVHSGGGH
GGHYYAFIRPALSDIWYKFDDERVTKEDMKRALEEQYGGEEELPHTNPGLNTTPLRFTKH
SNAYMLVYIRESDREKIICNLDENDIPEHLKIRLRKENEEREYKKKEKAEAHMFTALKVA
RDSDFAEQIGKHIYFDLVDYDNIQSLRAPKHLTINQAKVDLSKEFGIPVQSQRFWLWAKR
QNHTFRPVRPLTLQEEASSIGHLTDPSNKSLNSELKLFLEVALGQENHPISVPPKTKDDI
LIFFKLYDPEKEELRYVGKLLVKASGKPADIVQKLQEMAGFQSDEDIELYEEVMFEPSVM
CEPININDSFLSSQLEDGDIICYQKRCSPEKLDHYRCADVPSFFEYIQNRQVVHFRLLEN
PKDDDFTLELSKRFTYDDVVEKVANQLGLDDPSKLRLTQHLPYSQMPKSHYIKYRGLDHL
SDMLRNGNQMSDILYYEILDIPLPVLQDLITLRVAFYHATNNEVSSHFIRLPKGSTMSDL
IEDMKSKVNQLLVFFQVLCVHGNLMIFFQVELSYSDAEFRLFEVYKNKIRKVFQQFFCNS
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgcgcttcgagatggtttctattagggtttgggtgtttttttttactgagatg
cggtggagatttacaaaggtttgggttttggttgcatgtcctgttgtttgcagctcctgc
agcaggaccaggatgaggagatgctggtgccagaccaggatgttgttgttgagggacctc
agccgatggaaggtgagatttctctactctggatcaacagttgagaacgagcaggtacca
gaaacctctacgtccagatttacgtggaccattgaagatttttcgaatcacagaaagctg
tactctgatgtttttgtggttggggggcacaaatggcgggtgttagtttttccaactgga
aacagtgtacagtccctttcgatgtacctagatattgctgacgcaaatgaacagcctcat
ggatggagtaaatatgcacagttcagccttgctgtgatcaaccagttagacagcaagtac
tcactaagaaaagaagcagcacatcatttcagtactcgggaaagtgattggggcttcact
tcttttatgcatttaggagatctatatgatccgactaaaggttatattgtgaatgataaa
tgcattattgaggctgaggttgctgtgcgtaaaatagttgatttctggaattatgattcc
aaaaaggagactggctatgttggccttaagaatcaaggggctacatgctacatgaattct
cttcttcagacgctttaccatattccgtacttccgaaaggctgtataccatatgccaact
acagagaatgatacaccttgcgggagcatccctttggctttgcaaagtcttttctgcaaa
cttcagcatagtgacaatagtgtttctacaaaagagcttaccaaatcttttggatgggat
accgttgattctttcctgcagcatgatgttcaagaactgaatcgtgttctctgcgaaaaa
ctggaaaacaaaatgaagggaactactgtggaagggacaattcaacagctatttgaaggt
catcatatgaattatattgagtgcattaatgttgactacaaatctacaaggaaagaatca
ttctatgatcttgcacttgatgtcaagggctgttcagatgtttatgcatcatttgataag
tatgttgaagtagagagattggaaggtgataataaataccagtctgagaaacatggtttg
caggatgccaagaaagggatgctttttattgacttccctccagtcctgcaagttcaatta
aagcggtttgaatatgattttgtgcgggataccatggttaagataaatgaccgctatgag
ttcccattacaattagatcttgacaaggatgatggaaaatacctctctccagaagctgac
aggagggtgcgtaacctctatactctacacagcgtacttgttcatagtggtggtggtcat
ggtggacactactacgcctttatacgcccggcactttcagatatatggtacaagtttgat
gatgaacgagtgacaaaagaagacatgaagcgggcattagaggagcaatacggtggcgag
gaagagctcccacataccaatcctggattgaataccaccccgcttaggtttactaagcat
tcaaatgcttacatgcttgtgtacattcgtgaaagtgacagagaaaaaattatttgcaat
ttagatgaaaacgacataccagaacaccttaagattaggttgagaaaagaaaatgaagaa
agagagtataagaaaaaggagaaagcagaggcccacatgttcactgcattaaaggttgcc
cgagattctgattttgcagagcaaattggaaaacatatatattttgatcttgtggattat
gacaacatccaaagccttcgggcacctaaacatttgacaataaaccaggccaaggtcgat
ttatcaaaagaatttggtattcctgtacaatcccaacgattttggttatgggctaagcga
cagaaccacacatttagacccgtacgcccgttgactctccaggaggaagcatctagtatt
ggacaccttacagatccatcaaataaatcactcaattctgagttgaaactgttcttggag
gttgcattgggacaggaaaatcatcctatttctgtgcctccaaagacaaaggatgacata
ttaatattcttcaagctgtatgatcctgaaaaggaagagctaagatatgttggaaaactt
cttgtgaaagcatcagggaagccagctgatatagtgcaaaaattgcaagagatggcaggg
tttcagtcagatgaagatattgaactgtatgaggaagtaatgttcgagccaagtgtaatg
tgtgaacctattaacattaatgattccttcctttcaagccagcttgaagatggtgacatt
atatgctaccaaaaacgttgttctccagaaaagttggaccactatcgctgtgccgatgtg
ccatctttctttgaatatatccaaaatagacaggttgtccacttcagattacttgagaat
ccaaaagatgatgacttcactttggagctttcaaagcgtttcacgtatgatgatgttgtt
gaaaaagttgctaatcaacttggactcgatgatccttccaaactccgccttacacaacac
ctcccgtattcacagatgcccaaatctcactacattaagtatagaggtcttgatcatctt
tcggacatgctaaggaatggcaatcagatgtctgacatattgtattatgagatactggac
atccctttgccagtactgcaagatctgataacattgagagttgccttttatcatgctaca
aacaatgaggtgtcatctcactttatacggttgccaaaaggtagcactatgtctgatttg
attgaggacatgaaatccaaggtgaatcaactgctagttttctttcaagtgttgtgtgtg
catggcaatttaatgattttttttcaggttgagttatcttatagtgatgctgaattccgg
ttatttgaggtctacaaaaacaagatacgcaaggtatttcaacagttcttctgtaattct
taa

DBGET integrated database retrieval system