KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0802100-01Help
Entry
Os01t0802100-01   CDS       T02163                                 

Gene name
Os01g0802100
Definition
Similar to 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplast precursor (EC 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl- D-erythritol kinase) (CDPMEK).
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Os01t0802100-01 (Os01g0802100)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Os01t0802100-01 (Os01g0802100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(33971312..33971500,33972406..33972501,33972597..33972665,33973386..33973490,33973594..33973650,33973807..33974007,33974657..33974749,33974812..33974911,33975064..33975163,33975611..33975696,33976036..33976145)
AA seq 401 aa AA seqDB search
MACSTHLLSQSLYPLNRANPAAARGHLRFQASPSVRLGSGTSRRRALGLRVAASAEQGRR
QVEVEYDLQAKFNKLADQIDQNAGITRLNLFSPCKINVFLRITGKRPDGFHDLASLFHVI
SLGDTIKFSLSPSKSKDRLSTNVAGVPVDESNLIIKALNLYRKKTGTDNFFWIHLDKKVP
TGAGLGGGSSNAATALWAANQFSGCIASEKELQEWSGEIGSDIPFFFSQGAAYCTGRGEI
VEDIRNPLPANLPMVLVKPPEACSTAEVYKRLRLEHTSQTDPLVLLKEITENGISQDACV
NDLEPPAFEVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVGIGSPDPPAFVYDDDDYK
DTFVSEACFLTRNENEWYREPISSKITSEEDLPPEVASVSD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctccacccacctcctgtcccagagcctctacccgctcaaccgcgctaacccg
gcagccgcgcgcgggcacctccggttccaggcttctcccagtgtgaggctcggctccggc
accagtcgccgccgggcgctgggcctgagagtcgccgcgtcggcggagcaagggaggagg
caagtggaggttgagtatgatctacaagcaaagttcaacaagctagcggaccaaattgac
cagaatgctgggattacacggctgaacctattctcaccttgcaaaattaatgtgttcttg
aggataacgggtaagagaccagatgggttccatgacctggcttctctgtttcatgtgata
agtttgggtgatactatcaaattctcattgtcaccaagtaagagcaaagatcgcttgtca
accaatgtagcaggtgtcccagttgatgaaagcaatttgatcatcaaggcactcaatctt
taccgcaagaaaactggaactgacaactttttttggattcatcttgataagaaggtccct
actggtgctggtcttggtggtggaagcagtaatgctgcaactgcgctgtgggccgccaac
cagtttagtggctgcattgcttcagaaaaggagcttcaggagtggtctggagagatagga
tcggatattcccttcttcttttcacaaggagcagcgtattgtaccggtagaggagagatt
gttgaagatattcggaatccattgccagcaaatttgccgatggtactagtaaagccacct
gaagcatgctcaacagctgaagtttacaagcggctcaggttagagcacacaagtcaaact
gatcccttggtattgctcaaggaaattactgaaaatgggatatcacaggatgcctgtgtt
aatgatctagaacctccagcatttgaggtgttgccatcactaaagaggttgaagaaacgt
ataattgctgctaaccggggagattatgatgctgtttttatgtcaggaagtggaagcaca
attgttgggattggttcaccagatccgcctgcatttgtgtatgatgatgatgactacaag
gatacttttgtgtcagaggcctgcttcctcactcgtaatgagaacgagtggtacagagaa
ccaatctcatcgaaaatcactagcgaggaagatttacctccggaggtagcatcagtttct
gactga

DBGET integrated database retrieval system