KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0814900-01Help
Entry
Os01t0814900-01   CDS       T02163                                 

Gene name
Os01g0814900
Definition
Similar to Cytochrome b5 reductase.
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0814900-01 (Os01g0814900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Os01t0814900-01 (Os01g0814900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(34655220..34655331,34654710..34654851,34654529..34654619,34654339..34654416,34654058..34654138,34653867..34653956,34653184..34653249,34652621..34652707,34652417..34652509))
AA seq 279 aa AA seqDB search
MDLLHGESVQTTVAIAVAVVAVAAGGAFLLLRSRKPKGCLDPENFKKFKLVEKKQISHNV
ARFKFALPTPTSVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGHFELVIKMYPQG
RMSHHFREMKVGDYMSVKGPKGRFRYQVGQVRAFGMLAGGSGITPMFQVARAILENPNDI
TKVHLVYANVTHDDILLKEELDNMAKTYPDRFKIYYVLNQPPEVWNGGVGFVSQDMIKAH
LPAPAEDIQILRCGPPPMNKAMAAHLDELGYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgcacggggagagcgtccagaccacggtggccatcgccgtcgccgtcgtc
gcggtcgccgcgggcggcgccttcctcctcctccggtccaggaagcccaagggctgtttg
gatcctgagaacttcaagaagtttaaacttgtggaaaagaagcaaataagtcataacgtg
gccagattcaaatttgctcttccaactccaacctctgtattgggccttccaattggtcag
catatcagttgcagaggacaagatgctacaggcgaagaagtaatcaaaccttatacccct
actacattggattctgatctagggcattttgagcttgttattaagatgtaccctcaagga
agaatgtcacaccatttccgtgaaatgaaagttggtgattatatgtctgtgaagggacct
aagggtcgtttcagataccaagttgggcaagtgagagcttttggaatgctagctggtgga
tcaggcatcactcccatgttccaagttgcaagggcaattcttgagaaccctaatgatatc
acaaaagttcatttagtctatgcaaatgtcacgcatgacgacattcttctgaaggaagaa
ctggacaacatggccaaaacctaccctgatcgctttaagatctactatgtcttgaatcag
cctcctgaagtctggaacggtggcgttgggtttgtgtcacaggacatgattaaagctcat
ttgccagcacctgccgaggacattcaaatcttgaggtgtggtcctcctccgatgaacaag
gcaatggctgcgcaccttgatgagctcgggtacaccaaggagatgcagttccagttctaa

DBGET integrated database retrieval system