KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0839500-00Help
Entry
Os01t0839500-00   CDS       T02163                                 

Gene name
Os01g0839500
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Chromosome [BR:dosa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Os01t0839500-00 (Os01g0839500)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os01t0839500-00 (Os01g0839500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(36014173..36014592)
AA seq 139 aa AA seqDB search
MAPKAEKKPAEKKPVEEKAEKKPKAEKRVPGAKEGGGEKKGKKKAKKSVETYKIYIFKVL
KQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNKKPTITSREIQTSVRLVLPGE
LAKHAVSEGTKAVTKFTSS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagcccgcggagaagaagccggtggaggagaaggcggag
aagaagcccaaggccgagaagcgggtgccgggcgccaaggagggcggcggcgagaagaag
gggaagaagaaggccaagaagagcgtcgaaacttataagatctacattttcaaggtcctc
aagcaggtgcatcccgatatcgggatatcgtccaaggccatgtcgatcatgaactcgttc
atcaacgatatcttcgagaagctcgcccaggaggccgcccgtctcgcccgctacaacaag
aagccgaccatcacctcccgcgagatccagacctcggtgcgcctcgtcctccccggcgag
ctcgccaagcacgccgtctctgagggcaccaaggccgtcaccaagttcacgtcgtcttaa

DBGET integrated database retrieval system