KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0841600-01Help
Entry
Os01t0841600-01   CDS       T02163                                 

Gene name
Os01g0841600
Definition
Similar to Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase).
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dosa00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dosa00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:dosa00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:join(36129538..36129579,36129699..36129774,36129886..36130009,36130416..36130500,36130817..36130949,36131453..36131547,36131723..36131801,36131946..36132028,36132246..36132296)
AA seq 255 aa AA seqDB search
MAARKFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDVVEVVVSPPFVFLPQVKGLLRPD
FSVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALMGESSDFVADKIAYALS
QGIKVIACIGETLEQREAGTTMEVVAAQTKAIAEKISDWTNVVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLVTNVSPAVAESTRIIYRGSVNGANCKELAAKPDVDGFLVGGASLKP
EFVDIIKSATVKSSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggaagttcttcgtcggcggcaactggaaatgcaatgggacaggggaggac
gtgaagaagatcgtcaccgtcctcaacgaggccgaggtgccctccgaggacgtcgtcgag
gtggtggtgagcccgccgttcgtgttcctgccgcaggtgaagggtttgctccggccggac
ttctccgtcgccgcgcagaattgctgggtgcgcaagggcggcgccttcactggcgagatc
agtgccgagatgttggtgaacctgcaggtgccttgggtgattctgggacactctgagcgg
agagcgctgatgggcgaatcaagtgattttgttgctgacaaaattgcgtacgcactttcc
caaggtatcaaggtaattgcttgcattggtgagacccttgaacagagagaagcaggaaca
acgatggaagttgttgcagcgcaaactaaagctattgcagagaagatatccgattggacc
aatgttgttttggcatatgaaccagtttgggccattggaaccggcaaggttgcaacccct
gctcaggctcaggaggttcatgatggtctgagaaagtggcttgtgactaatgttagtcct
gcagttgctgaatcaaccaggattatttacagaggctccgtaaatggagcaaactgcaaa
gaacttgctgctaaacctgatgttgatggattccttgttggaggagcttcattgaagcct
gaatttgtggacatcatcaagtctgctaccgtcaagtcttctgcttag

DBGET integrated database retrieval system