KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0841600-01Help
Entry
Os01t0841600-01   CDS       T02163                                 

Gene name
Os01g0841600
Definition
(RAP-DB) Similar to Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase).
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00051  Fructose and mannose metabolism
dosa00562  Inositol phosphate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
dosa01230  Biosynthesis of amino acids
Module
dosa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dosa_M00002  Glycolysis, core module involving three-carbon compounds
dosa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0841600-01 (Os01g0841600)
   00051 Fructose and mannose metabolism
    Os01t0841600-01 (Os01g0841600)
   00562 Inositol phosphate metabolism
    Os01t0841600-01 (Os01g0841600)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os01t0841600-01 (Os01g0841600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Os01t0841600-01 (Os01g0841600)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Os01t0841600-01 (Os01g0841600)
  Exosomal proteins of bladder cancer cells
   Os01t0841600-01 (Os01g0841600)
  Exosomal proteins of melanoma cells
   Os01t0841600-01 (Os01g0841600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
RAP-DB: Os01t0841600-01
Position
chr01:join(36129538..36129579,36129699..36129774,36129886..36130009,36130416..36130500,36130817..36130949,36131453..36131547,36131723..36131801,36131946..36132028,36132246..36132296)
AA seq 255 aa AA seqDB search
MAARKFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDVVEVVVSPPFVFLPQVKGLLRPD
FSVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALMGESSDFVADKIAYALS
QGIKVIACIGETLEQREAGTTMEVVAAQTKAIAEKISDWTNVVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLVTNVSPAVAESTRIIYRGSVNGANCKELAAKPDVDGFLVGGASLKP
EFVDIIKSATVKSSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggaagttcttcgtcggcggcaactggaaatgcaatgggacaggggaggac
gtgaagaagatcgtcaccgtcctcaacgaggccgaggtgccctccgaggacgtcgtcgag
gtggtggtgagcccgccgttcgtgttcctgccgcaggtgaagggtttgctccggccggac
ttctccgtcgccgcgcagaattgctgggtgcgcaagggcggcgccttcactggcgagatc
agtgccgagatgttggtgaacctgcaggtgccttgggtgattctgggacactctgagcgg
agagcgctgatgggcgaatcaagtgattttgttgctgacaaaattgcgtacgcactttcc
caaggtatcaaggtaattgcttgcattggtgagacccttgaacagagagaagcaggaaca
acgatggaagttgttgcagcgcaaactaaagctattgcagagaagatatccgattggacc
aatgttgttttggcatatgaaccagtttgggccattggaaccggcaaggttgcaacccct
gctcaggctcaggaggttcatgatggtctgagaaagtggcttgtgactaatgttagtcct
gcagttgctgaatcaaccaggattatttacagaggctccgtaaatggagcaaactgcaaa
gaacttgctgctaaacctgatgttgatggattccttgttggaggagcttcattgaagcct
gaatttgtggacatcatcaagtctgctaccgtcaagtcttctgcttag

DBGET integrated database retrieval system