KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0841600-01Help
Entry
Os01t0841600-01   CDS       T02163                                 

Gene name
Os01g0841600
Definition
Similar to Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase).
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os01t0841600-01 (Os01g0841600)
   01230 Biosynthesis of amino acids
    Os01t0841600-01 (Os01g0841600)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0841600-01 (Os01g0841600)
   00051 Fructose and mannose metabolism
    Os01t0841600-01 (Os01g0841600)
   00562 Inositol phosphate metabolism
    Os01t0841600-01 (Os01g0841600)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os01t0841600-01 (Os01g0841600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Os01t0841600-01 (Os01g0841600)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Os01t0841600-01 (Os01g0841600)
  Exosomal proteins of bladder cancer cells
   Os01t0841600-01 (Os01g0841600)
  Exosomal proteins of melanoma cells
   Os01t0841600-01 (Os01g0841600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:join(36129538..36129579,36129699..36129774,36129886..36130009,36130416..36130500,36130817..36130949,36131453..36131547,36131723..36131801,36131946..36132028,36132246..36132296)
AA seq 255 aa AA seqDB search
MAARKFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDVVEVVVSPPFVFLPQVKGLLRPD
FSVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALMGESSDFVADKIAYALS
QGIKVIACIGETLEQREAGTTMEVVAAQTKAIAEKISDWTNVVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLVTNVSPAVAESTRIIYRGSVNGANCKELAAKPDVDGFLVGGASLKP
EFVDIIKSATVKSSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggaagttcttcgtcggcggcaactggaaatgcaatgggacaggggaggac
gtgaagaagatcgtcaccgtcctcaacgaggccgaggtgccctccgaggacgtcgtcgag
gtggtggtgagcccgccgttcgtgttcctgccgcaggtgaagggtttgctccggccggac
ttctccgtcgccgcgcagaattgctgggtgcgcaagggcggcgccttcactggcgagatc
agtgccgagatgttggtgaacctgcaggtgccttgggtgattctgggacactctgagcgg
agagcgctgatgggcgaatcaagtgattttgttgctgacaaaattgcgtacgcactttcc
caaggtatcaaggtaattgcttgcattggtgagacccttgaacagagagaagcaggaaca
acgatggaagttgttgcagcgcaaactaaagctattgcagagaagatatccgattggacc
aatgttgttttggcatatgaaccagtttgggccattggaaccggcaaggttgcaacccct
gctcaggctcaggaggttcatgatggtctgagaaagtggcttgtgactaatgttagtcct
gcagttgctgaatcaaccaggattatttacagaggctccgtaaatggagcaaactgcaaa
gaacttgctgctaaacctgatgttgatggattccttgttggaggagcttcattgaagcct
gaatttgtggacatcatcaagtctgctaccgtcaagtcttctgcttag

DBGET integrated database retrieval system