KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0848200-01Help
Entry
Os01t0848200-01   CDS       T02163                                 

Gene name
Os01g0848200
Definition
Similar to Delta 1-pyrroline-5-carboxylate synthetase (P5CS) [Includes: Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase) (GK); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)].
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os01t0848200-01 (Os01g0848200)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Os01t0848200-01 (Os01g0848200)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Os01t0848200-01 (Os01g0848200)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Os01t0848200-01 (Os01g0848200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(36431167..36431283,36431953..36432024,36432124..36432227,36432308..36432410,36432498..36432659,36432784..36433061,36436169..36436319,36436536..36436700,36436818..36436895,36437025..36437114,36437201..36437287,36437377..36437463,36437535..36437631,36437774..36437877,36438176..36438251,36438695..36438845,36438987..36439055,36439149..36439215,36439366..36439436,36439650..36439728)
AA seq 735 aa AA seqDB search
MGRGGIGGAGLVAAVAKADVENTDSTRGFVKDVKRIIIKVGTAVVTGPNGRLAMGRLGAL
CEQVKQLNFEGYEVILVTSGAVGVGRQRLKYRKLVNSSFADLQNPQMDMDGKACAAVGQS
VLMAIYDTLFSQLDVTSSQLLVTDRDFMDPSFGNQLRETVNSLLDLKVIPVFNENDAIST
RRQPYEDSSGIFWDNDSLARLLAQELKADLLIMLSDVEGLYSGPPSDPQSKIIHTYVHEQ
HGKLISFGEKSRVGRGGMQAKVAAAFTASSKGIPVVIASGFAIDSIIKVMRGEKIGTLFH
REANQWGCSKEATAREMAVAARDCSRHLQKLSSEERKKILLDIADALEANEDLITSENQA
DLDLAQDIGYDKSLVARMTIKPGKIKSLAGSIREIADMEDPISHTLKRTEVAKDLVFEKT
YCPLGVLLIIFESRPDALVQIASLAIRSGNGLLLKGGKEAMRSNTILHKVITGAIPDVVG
KKLIGLVKNKDEIADLLKLDDVIDLVIPRGSNKLVSQIKAATKIPVLGHADGICHVYIDK
SADMDMAKRIVLDAKVDYPAACNAMETLLVHKDLNRTEGLDDLLVELEKEGVVIYGGPVA
HDTLKLPKVDSFHHEYNSMACTLEFVDDVQSAIDHINRYGSAHTDCIITTDGKAAETFLQ
QVDSAAVFHNASTRFCDGARFGLGAEVGISTGRIHARGPVGVDGLLTTRCILRGSGQVVN
GDKGVVYTHRELPLQ
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggggagaggagggatcggcggcgcggggctggtggcggcggtcgcgaaggcggacgtg
gagaacaccgactccacccgcggcttcgtcaaggacgtgaagcgcatcatcatcaaggtc
ggcaccgctgttgtgactgggccgaatggccggttggctatgggcaggctcggtgctctg
tgtgaacaggtgaagcagctaaattttgaggggtacgaggtgattctggtcacctctggt
gctgttggtgttgggaggcagaggctcaagtaccggaagctcgtcaatagcagtttcgct
gatctgcagaacccacagatggacatggacgggaaggcctgcgctgccgtcggtcagagt
gtgctgatggcgatctatgacacgttatttagccagcttgacgtaacatcatctcagctt
cttgttacggatcgtgattttatggatccaagttttgggaaccagctccgcgagactgtt
aattctctgttagatctcaaggttataccagtatttaatgagaatgacgccatcagtacc
aggaggcaaccatacgaggattcatctggcatattctgggataacgatagtttggccaga
ctgttagcgcaagaacttaaagctgatctccttatcatgctcagtgatgtggaggggctc
tatagcggtccacctagcgatccacaatcgaagattatccacacatacgtccatgaacaa
catgggaagttaattagctttggggagaaatctcgtgtgggaagaggtggaatgcaagct
aaagtagcagctgcttttactgcttcatcaaaaggaatacctgttgtaattgccagtgga
tttgcaatcgatagcattattaaggtcatgcgaggagagaaaatcggtacgcttttccat
agggaagcaaaccagtggggttgttccaaggaagcaacagcgcgtgagatggccgttgct
gcaagagattgctccagacatctacagaaattgtcgtctgaggagcgtaagaagattttg
ctagacatcgccgatgctctagaagcaaatgaagatctaattacatccgagaaccaagct
gatctggatttggcgcaagatattggttacgataaatcattggttgctcggatgaccata
aagccaggaaagataaaaagcctcgcaggatcaattcgtgaaatcgctgatatggaggac
cctatttcccatacactgaaaagaacagaggttgctaaagatcttgtttttgagaaaaca
tattgcccattgggtgttctcctaattatttttgagtcccgtcctgatgccttggtacag
attgcatctttagcaatccgaagtggaaatggtcttctcttgaaaggaggaaaagaagct
atgagatcaaacacaatactgcataaggtcataactggtgcaattccagatgttgttggt
aaaaaacttattggcctagtgaaaaacaaagatgaaattgctgatttgctcaagcttgat
gatgtgattgatcttgtaataccaagaggtagcaataagctcgtttcccagatcaaagca
gcaaccaagattcctgttcttggtcatgctgacggtatctgccatgtttatattgacaaa
tcagctgacatggacatggcaaaacgtattgtattggacgcaaaggttgattatccagca
gcgtgtaatgccatggaaacgttacttgttcataaagatctgaacaggacagaaggcctt
gacgatttattggtggagcttgaaaaggaaggggtagttatctatggcgggcctgttgca
catgacactttgaaactaccaaaggtagattcatttcatcatgagtataactcaatggca
tgcaccctcgaatttgttgatgatgtgcagtcagcaattgaccatataaatcgctatgga
agtgcacacacagattgcattatcactactgatggaaaggcagcagagacttttctacag
caagttgatagtgctgcggtattccataatgcaagcacacggttctgtgatggggctcgc
tttggtctaggtgctgaggttggcataagcacagggcgcatacatgctcgggggcctgtt
ggcgttgatggactcctaacaactcgatgcattttacgaggaagtggacaagtagtgaac
ggcgacaagggagttgtttacacccacagggagctccctttgcagtga

DBGET integrated database retrieval system