KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0851600-01Help
Entry
Os01t0851600-01   CDS       T02163                                 

Gene name
Os01g0851600
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal domain containing protein.
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    Os01t0851600-01 (Os01g0851600)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Os01t0851600-01 (Os01g0851600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:36667119..36667925
AA seq 268 aa AA seqDB search
MGGGGGDDALYARCLVILYLISPITVFLLRFVSAPYGKLSRPGWGPAVPAALAWFLMESP
TMCLPPLVLSAAASSSALRAAALLPAALYALHYVNRTLVHPLRLLRLRRAPAPVPILVAA
FAFGFNLLNAYVQARSWALDAAAPHSTATATATPAAVARCLVGLALFAWGMRTNIAADKA
LLRLKEAGKGYQIPRGGLFDVVTCPNYFGEAVEWLGYALVAWTPAAWAFFLYTCSNLGPR
ARDHRRWYVGKFGDKYPASRKAFVPYIY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcggcggcggcgacgacgcgctgtacgcgcgatgcctggtgatcctgtacctg
atcagcccgatcaccgtgttcctgctccggttcgtgtcggcgccgtacgggaagctctcc
cgccccgggtggggtcccgccgtgccggcggcgctcgcgtggttcctcatggagagcccc
accatgtgcctcccgcccctcgtcctctccgccgccgcctcctcgtcggcgctgcgcgcc
gccgctctcctcccggccgcgctgtacgcgctccactacgtgaaccgcacgctcgtccac
ccgctccggctcctccgcctccgccgcgcgccggcgcccgttccgatcctcgtcgccgcc
ttcgccttcggcttcaacctcctcaacgcctacgtccaggcgcgctcctgggcgctcgac
gccgccgctccccacagcaccgccaccgccaccgccacgcccgcggccgtcgcccgctgc
ctcgtcgggctagccctcttcgcgtgggggatgcggaccaacatcgcggcggacaaggcg
ctcctgaggctgaaggaggccgggaaagggtaccagattccccgcggcgggctgttcgac
gtggtcacctgccccaactacttcggcgaggccgtggagtggctcggctacgcgctggtg
gcgtggacgccggcggcctgggccttcttcctctacacctgctccaacctcgggccgagg
gccagggatcaccgccggtggtacgtcggcaagttcggcgacaagtacccggcgtcgcgc
aaggcgttcgtcccgtacatctactga

DBGET integrated database retrieval system