KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0865100-01Help
Entry
Os01t0865100-01   CDS       T02163                                 

Gene name
Os01g0865100
Definition
Similar to Uricase (Fragment).
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Os01t0865100-01 (Os01g0865100)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Os01t0865100-01 (Os01g0865100)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Os01t0865100-01 (Os01g0865100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(37444358..37444558,37444186..37444278,37444015..37444090,37442688..37442797,37442277..37442368,37441818..37441991,37441616..37441709,37440900..37440983))
AA seq 307 aa AA seqDB search
MADRLELQGRHGKSRVRVSRVWRRPAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVA
TDSIKNTVYVKAKECTEIVSMEEFAVILGRHFTSLYPQVSEATVTIAERPWERVVVDGKP
HSHGFKLGVEKHVTEVIVKKSGNLLINSGIQGYSLLKTTQSGFEKFVRDRYTLLPDTRER
IVATEVTAWWRYPFEHVSQIPSKSFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQNTLY
LMAKEVLNRFPDIASVQLRMPNLHFIPVNLGNKENPGLVKFADDVYLPTDEPHGTIEATV
SRPKSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcgcctcgagctccagggcaggcacggcaagtcccgcgtccgcgtctcccgc
gtctggcgccgccccgcggccgcgggaggccacgtcatcgtcgagtggaacgtggccgtc
agcgtcgtctccgactgcctcccctcctacacctccgacgacaactccgccatcgtcgcc
accgattccatcaagaacaccgtgtatgtgaaggccaaggaatgcacggagattgtctcc
atggaggaattcgcggtgattcttggaaggcatttcacctcgctgtacccgcaggtctca
gaggcaacggtgaccatcgccgagcgtccatgggagcgtgtggttgtcgatgggaagcct
cattcccacgggttcaaacttggtgttgagaagcacgtcacagaggtcattgtgaagaag
tctggaaacttgctcataaattctggaatccaaggatactccctgctaaagacaactcag
tccgggttcgaaaaatttgtgagggatcgctacacacttcttcctgatacaagagaaagg
attgtagcaacagaagtaactgcctggtggaggtatccttttgagcatgtttcccagatt
ccatcaaagtcattctgcttcacacaaaggtatcaggacgtaaagaaagttcttgcagat
acgttctttggtcctcctgatgttggagtgtatagtccatcagtgcagaatacactatac
ctgatggctaaggaagttctcaacaggttcccggatatagcatctgttcagctaaggatg
ccgaacctccactttatccctgttaacttagggaacaaagaaaatccaggattagtgaag
tttgctgatgatgtgtacctgccgaccgatgaaccacacgggaccattgaagcaacagtg
agccgccccaagtcaaagttgtaa

DBGET integrated database retrieval system