KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0885000-01Help
Entry
Os01t0885000-01   CDS       T02163                                 

Gene name
Os01g0885000
Definition
Similar to Cytochrome c.
Orthology
K08738  
cytochrome c
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Os01t0885000-01 (Os01g0885000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:join(38443699..38443810,38444908..38445041,38446043..38446132)
AA seq 111 aa AA seqDB search
MATFSDAPPGDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSG
DKIVPVIWEENTLYDYLLTPKKYTPAKMGFNGLKQPQDRADLIAYLKNATA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattctccgatgcgccgcccggggacgcggcggccggcgagaagatcttcagg
accaagtgcgcgtactgccatgccgtcgacaaggccgccggccacaagcatgggccaaac
ttgaacggtttgtttgggaggcaatctggtacagctcctggtttctcttacccatctggc
gacaagatagtgcctgtgatttgggaagagaacactttgtatgactacctgcttactcct
aagaagtacactcctgccaagatggggttcaatggactgaagcagccacaggaccgtgct
gatctcatcgcatacctgaagaacgccacagcatga

DBGET integrated database retrieval system