KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0891000-01Help
Entry
Os01t0891000-01   CDS       T02163                                 

Gene name
Os01g0891000
Definition
Glycoside hydrolase, family 20 protein.
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0891000-01 (Os01g0891000)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Os01t0891000-01 (Os01g0891000)
   00603 Glycosphingolipid biosynthesis - globo series
    Os01t0891000-01 (Os01g0891000)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Os01t0891000-01 (Os01g0891000)
   00511 Other glycan degradation
    Os01t0891000-01 (Os01g0891000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Os01t0891000-01 (Os01g0891000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr01:complement(join(38745216..38745533,38745049..38745123,38744200..38744235,38744014..38744125,38743687..38743757,38743436..38743566,38742690..38742755,38742337..38742437,38742056..38742115,38741932..38741965,38741702..38741800,38741560..38741619,38741051..38741301,38740249..38740415))
AA seq 526 aa AA seqDB search
MAQALSLGLLLAFLAIQSCIAIELTDHIDLWPMPTSVSHGTQRLYVSKDITMSMEGSTYP
DGKGILKDAFQRVVDLMKLNHVVDGANPSSFVLTGVNVVVHSPEDELKFGVDESYNLSVP
TAGYPLRVQIEAQTVFGALHALQTFSQLCYFDFTSKLIELISAPWRISDTPRFPYRGLLI
DTSRHYLPVTVIKKVIDTMAYSKLNVLHWHIVDAQSFPIEIPSYPKLWNGSYSFSERYTT
SDAVDIVRYAENRGVNVMAEIDVPGHALSWGVGYPSLWPSDSCKEPLDVSNNFTFGVIDG
ILSDFSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNQMNVSDAYRYFVLRSQKLAIS
HGYDVINWEETFNNFGDKLDRRTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDAT
WEGFYTNEPLKGIDDPEQQSLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEK
IAEDPRLVTSRLARFRCLLNQRGVAAAPVAGYGRTAPYEPGPCVRQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggctctgagtttggggttgcttcttgcgtttctggcaattcaatcctgcatc
gccattgagctgactgatcacatcgacttgtggcctatgccaacgtcggtgagccatgga
acacaaagactttatgtcagcaaagatatcacaatgtcaatggagggaagcacgtatcct
gacgggaaagggatcttgaaggatgccttccagagggtagttgatttaatgaaactgaac
catgtcgttgatggtgcaaacccaagttcttttgtactcactggtgtaaatgtagttgtc
cattcacctgaagatgagctcaaattcggagtagatgaatcatataacttatctgttcct
acagcaggatatccattgcgcgtacagattgaggctcaaacagtatttggagcacttcat
gctttacagacatttagccaactgtgttacttcgatttcacatcaaaacttatagaactc
atctcggctccttggagaatttctgacacaccaagatttccttaccgaggacttcttatt
gatacctcaaggcactaccttcctgttacggtaattaaaaaagtgattgatacaatggcc
tacagtaaattgaacgttctccattggcatattgtggatgcacagtcatttcccattgaa
ataccttcataccctaaactgtggaacggttcatattctttttcagagagatatacgacg
tctgatgctgtagacattgtacgatatgctgaaaatcgaggtgtaaatgttatggctgag
attgatgttcctggtcatgctctgtcatggggcgttggctacccatcattgtggccatca
gatagctgcaaagaaccacttgatgtcagtaacaacttcacgtttggagttattgatgga
attctttcagattttagcaaagtttttaaattcaaatttgtgcatttaggaggtgatgaa
gtcaacacaagctgctggactgcaacaccccacattaagaaatggttggatgataaccaa
atgaatgtgtcagatgcatacagatattttgtgttgagatcccaaaagctagcaatatca
cacggttatgatgtcatcaactgggaggaaacatttaacaattttggagacaaattggac
cgtagaaccgtggttcataactggcttggagaggatgtagcaccaaaagtggttgcggca
gggctgagatgcatcgtaagcaaccaggataagtggtacctagatcacttagatgccaca
tgggaggggttttacacgaatgaacctctgaaaggtattgacgacccagagcagcaaagt
ttggtcattggtggtgaggtttgtatgtggggcgaacaaattgacgcatcggatattgaa
caaaccatttggccacgtgctgcagctgctgcagagagactatggactcctattgagaag
attgcagaagacccaagattggtcacgtcaagattggcacgcttcaggtgtttgctgaac
caaagaggggtagctgctgcaccggtggctgggtatggccgtacagcaccatatgaacct
ggtccctgtgtaaggcaatag

DBGET integrated database retrieval system