KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0970400-01Help
Entry
Os01t0970400-01   CDS       T02163                                 

Gene name
Os01g0970400
Definition
Eukaryotic translation initiation factor 4E-1 (eIF4E-1) (eIF-4E-1) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) (eIF-4F p26 subunit).
Orthology
K03259  
translation initiation factor 4E
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os01t0970400-01 (Os01g0970400)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Os01t0970400-01 (Os01g0970400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr01:join(42812027..42812301,42813817..42813982,42814066..42814191,42814784..42814849,42814927..42814977)
AA seq 227 aa AA seqDB search
MAEEHETRPPSAGRPPSSGRGRADDADEREEGEIADDDSGHAPPQANPAAPHPLEHAWTF
WFDNPQGKSKQATWGSSIRPIHTFSTVEDFWSLYNNIHHPSKLVVGADFHCFKNKIEPKW
EDPICANGGKWTFSCGRGKSDTMWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWT
KNAANEAAQISIGKQWKEFLDYKDSIGFIVHDDAKKMDKGLKNRYTV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagcacgagacgaggccgccgtccgccggaaggccgccgtcgtccggccgc
ggcagggccgacgacgctgacgagagggaggagggggagatcgccgacgacgactccggc
cacgcgccgccgcaggccaaccccgccgcgccgcacccgctcgagcacgcctggaccttc
tggttcgacaacccgcagggaaagtccaagcaggcaacctggggaagctccatccgcccc
atccacaccttctccaccgtcgaggacttctggagcctttataacaatatccatcaccca
agcaagttggttgtgggagctgacttccattgctttaagaataaaatcgagccaaaatgg
gaagatcctatctgtgctaatggaggtaaatggaccttcagctgtggcagaggaaagtcc
gacacaatgtggttgcatactttattggcaatgattggcgaacaattcgattatggggat
gaaatttgtggagcagttgttagtgtgcgtggcaagcaggaaagaatagctatctggact
aaaaatgctgccaatgaagctgctcagataagcattgggaagcagtggaaagaatttctg
gattacaaggactcgattgggttcattgttcatgacgatgcaaaaaagatggacaaaggt
ctcaagaaccgctacacagtttga

DBGET integrated database retrieval system