KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0100100-01Help
Entry
Os02t0100100-01   CDS       T02163                                 

Gene name
Os02g0100100
Definition
Thioredoxin domain domain containing protein.
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dosa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(7753..8255,7538..7667,7262..7430,7045..7163,6873..6953,6619..6705,6419..6493,5884..5952,5728..5808,5514..5648,4861..4917,3864..4049))
AA seq 563 aa AA seqDB search
MRSRSLLLVALATLLLHASASASDDDLDYLIDNADDIPANDPDGWLQEGSPDDDDDDDLF
HHGQAQDHPIDETHVFLLSAANFSDFLASHRHVMVEFYAPWCAHCQALAPDYAAAAADLS
PLAHQVALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPKDYNGARTKEAIVSWVNKKLA
PGVQNITTVDEAEKILTGEDKAILAVLDSLSGAHSDEIAAASRLEDAINFYQTSNPDVAK
LFHLDPAAKRPSLVLLKKQEEEKLTFYDGPFKASAIADFVSANKLPLVNTLTQETAPSIF
DNPIKKQILLFVVANESSKFLPIFKEASKSFKGKLLFVFVERDNEEVGEPVANYFGITGQ
ETTVLAYTGNEDARNFFLDGEISVENIKRFAEDFLEEKLTPFYKSEPVPESNEGDVKIVV
GKNLDQIVLDESKDALLEIYAPWCGHCQELEPTYNKLGKHLRGIDSLVIAKMDGTANEHP
RAKPDGFPTILFYPAGKKSFEPITFEGDRTVVEMYKFIKKHASIPFKLKRPDSSATKTEK
DQSTASTNLRGERSSGTNFKDEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcc
tccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaac
gaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttc
caccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgcc
gccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccc
tggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcc
cctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcc
cagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaag
gactacaacggcgcaagaaccaaggaagccatcgtgtcgtgggtcaacaagaagctagct
cccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggac
aaggccattcttgccgtcctcgactccctatcgggtgctcacagtgatgagattgctgct
gcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaag
ctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagag
gaggagaagttgaccttctatgatgggccattcaaagcatctgcaattgccgattttgta
tctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccattttt
gacaatccaatcaagaagcagattttactatttgttgttgcaaacgaatcgtcgaaattt
ctgcccatctttaaggaagcatcaaaatcattcaaggggaagcttttgtttgtctttgtg
gagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaa
gagaccacagttcttgcttacactgggaatgaagatgctaggaattttttccttgatggt
gaaatatcggtagagaatattaagagatttgctgaggatttcttagaggaaaagctcaca
ccgttctacaagtctgaacctgtacctgaatctaatgaaggagatgtcaaaattgttgtt
ggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggagatatat
gcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcat
ctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatcca
cgtgcaaagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagtttt
gagcctattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaag
cacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaag
gatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaag
gatgagttgtag

DBGET integrated database retrieval system