KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0105200-01Help
Entry
Os02t0105200-01   CDS       T02163                                 

Gene name
Os02g0105200
Definition
(RAP-DB) Similar to Dihydrolipoamide S-acetyltransferase (EC 2.3.1.12).
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00020  Citrate cycle (TCA cycle)
dosa00620  Pyruvate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Module
dosa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os02t0105200-01 (Os02g0105200)
   00020 Citrate cycle (TCA cycle)
    Os02t0105200-01 (Os02g0105200)
   00620 Pyruvate metabolism
    Os02t0105200-01 (Os02g0105200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Os02t0105200-01 (Os02g0105200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N Trypan_PARP
Motif
Other DBs
RAP-DB: Os02t0105200-01
Position
chr02:join(287728..287763,287980..288082,288808..288881,288965..289062,289340..289380,289977..290032,290170..290244,290377..290469,290602..290850,290930..291002,291681..291766,291853..291938,292067..292142,292280..292347,292430..292496,292570..292665,292741..292843,293214..293309,293396..293466)
AA seq 548 aa AA seqDB search
MSAAHLLRHSRKLRTLRDALDYDRSALVRYFSAASASFPTKGGAAAGVEKRIGGARFPQC
KQPGKELETFKVSLGGLNGRYACRRAPNNCIPTTITGLNGSLSCGQVSSARSFSSSADLP
PHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKII
HGDGAKEIKVGEIIAVTVEEEGDLEKFKDYKPSTSAAPAAPSEPKAQPEPAEPKVKETEP
SRTPEPKAPKTEEASQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIEDYLA
SVAKGGKREALAAPGLSYTDVPNTQIRKVTANRLLSSKQTIPHYYLTVDARVDNLIKLRG
ELNPLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMSDFIRQYHNVNINVAVQTEHG
LFVPVIRDADKKGLGTIAEEVKQVAQRARDNSLKPEDYEGGTFTISNLGGPFGIKQFCAI
INPPQSAILAIGTAEKRVIPGSVDGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYI
ENPNSMLL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggcgcacctcctccgccactcccgcaagctgcggactctacgtgatgctcta
gattatgatcggtctgctcttgtacgctacttctccgctgcttctgcatcctttcccaca
aagggaggtgctgctgctggtgttgagaaaagaattggtggcgccagattccctcagtgc
aagcagcctgggaaagagcttgagaccttcaaggtgtcactaggaggactaaatggaaga
tatgcttgtagaagagcacctaacaattgtatcccaaccactattaccggtctcaacggt
tcattgtcatgtggacaggtgtcttcagcaagatctttctcaagcagtgcagacctgcca
ccacatcaggaaattgggatgccatcactctctcctacaatgactgaggggaacattgca
aggtggctgaagaaggaaggagataaggtctcacctggtgaagttctctgtgaggtggag
acggataaagccactgtagagatggagtgcatggaagagggctatctcgctaagatcatt
catggagatggtgccaaagagatcaaagttggtgagatcattgctgtaactgtggaagaa
gagggtgaccttgagaagtttaaggattataaaccttcaacttcagctgcacctgcagcc
ccttctgaaccgaaggctcagcctgagcctgcagagccaaaggtgaaggagacagagcct
tccaggactcctgagccgaaagccccaaagactgaagaagcttctcaaccagggggtcga
atattctccagccctcttgcaagaaaattggcagaagataacaatgttccactgtcaagc
gtaatgggaactggtcctgatgggcgaattttgaaggcggacattgaagattacttggct
tctgtagcaaagggtggcaaaagggaagctcttgcggctccagggttaagttacactgat
gttcctaatactcagataagaaaggttactgcaaaccgcctgctaagctctaaacaaact
attcctcattattacttgacagttgacgcccgtgttgataatcttatcaagttgcgaggg
gaactgaatccgttgcaagagtcatctggcggtaagaagatatctattaacgatcttgtt
ataaaggctgcagctctggctcttcgaaaggtccctcagtgtaatagctcgtggatgagt
gattttatccgccaataccacaacgtgaacatcaatgttgctgtacagactgagcatggg
ttgtttgttccagtaattagggatgcagacaagaagggacttggtacaattgctgaggag
gtgaagcaggtggctcaaagagcaagggataacagcttaaaacctgaagattatgaggga
ggcacattcaccatatcaaacctaggaggtcctttcggaatcaaacaattctgtgccatc
ataaatcctcctcagtcagcaatcttggccattggtactgctgagaagagggtgatacct
ggcagcgtagacggccagtatgagtttggttccttcatgtcggcaacaatgagctgtgat
cacagggttattgatggtgctatcggcgcagaatttctgaaagcattcaagggctatatc
gagaatccaaactcaatgttactgtga

DBGET integrated database retrieval system