KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0117700-01Help
Entry
Os02t0117700-01   CDS       T02163                                 

Gene name
Os02g0117700, UGP2, UDP-GLUCOSE_PYROPHOSPHORYLASE_2
Definition
(RAP-DB) UDPase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00040  Pentose and glucuronate interconversions
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa00520  Amino sugar and nucleotide sugar metabolism
dosa01100  Metabolic pathways
Module
dosa_M00361  Nucleotide sugar biosynthesis, eukaryotes
dosa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os02t0117700-01 (Os02g0117700)
   00052 Galactose metabolism
    Os02t0117700-01 (Os02g0117700)
   00500 Starch and sucrose metabolism
    Os02t0117700-01 (Os02g0117700)
   00520 Amino sugar and nucleotide sugar metabolism
    Os02t0117700-01 (Os02g0117700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Os02t0117700-01 (Os02g0117700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DUF1647
Motif
Other DBs
RAP-DB: Os02t0117700-01
Oryzabase: 7491
Position
chr02:complement(join(929810..929868,929656..929703,929354..929536,929177..929237,929002..929079,928874..928924,928721..928794,928556..928628,928403..928460,928244..928290,928100..928165,927899..927931,927755..927807,927596..927671,927462..927518,927298..927381,927129..927227,926928..927032,926637..926708,926333..926359))
AA seq 467 aa AA seqDB search
MADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDT
LAAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYTNSNIEVHTFNQSQYPRVVADEFLPWPSKGKT
CKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTL
KVSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagctcgccaagctgcgtgaagccgtcgccggcctctcgcagatcagt
gacaacgagaagtccgggttcatcagcctcgtcgcccgctacctcagtggcgaggaggag
catgtggaatgggcaaagatccacacgccgacggacgaggtggtggtgccgtacgacacc
ctggcggcgccgccggaggacttggaggagaccaagaagctgctcaacaagctcgccgtg
ctcaagctcaacggcggcctcggcaccaccatgggatgcaccggaccaaaatcggtcatc
gaagtgcgcaacggattcacattcctcgacttgattgtgatccagatcgagtccctcaac
aagaagtatggcagcaatgtcccactgcttctgatgaactcattcaacacccatgaagac
accttgaagattgttgagaaatacaccaattcgaacattgaagtccatactttcaatcag
agccagtatcctcgtgtggtagccgatgagttcttgccatggccttccaaggggaagacc
tgcaaggatggctggtaccctcctggccatggtgatatcttcccatccctgatgaacagt
ggcaagcttgatttgttactttcacagggaaaggagtatgtgttcattgcaaactcagat
aacttgggtgctatagtggacatgaagatactgaaccatttgatccacaaacagaatgaa
tattgcatggaggttaccccgaaaactctggctgatgttaaaggtggcacactgatctca
tatgaagacaaggttcagctcctggagattgcacaagttcctgatgcacatgtgaatgaa
ttcaaatccatcgagaaattcaagatcttcaacacgaacaatctatgggtgaacttgaag
gctatcaagcgccttgttgaggctgatgcactaaagatggagatcattccaaaccctaag
gaagtggatggagttaaagttcttcagttggaaacagcagctggtgcagcaatcaggttc
tttgatcacgcaattggtatcaatgttccaaggtcccggttcctaccagtgaaggcaaca
tcagatttgcagctagtacagtctgatctatataccttggttgatggctttgttacacgc
aacccggccagaacaaacccatcgaatccctcaattgaactgggtccagagttcaagaag
gtcgggtgtttccttggtcgcttcaagtcaatccccagcattgttgagcttgacaccttg
aaggtttccggtgatgtttggtttggctctagcatcacattgaagggcaaggtgaccatc
acagcccaacctggtgtcaaactggaaatcccagatggagcagtgatcgagaacaaggat
atcaatggccccgaggacctttga

DBGET integrated database retrieval system