KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0117700-01Help
Entry
Os02t0117700-01   CDS       T02163                                 

Gene name
Os02g0117700, UGP2, UDP-GLUCOSE_PYROPHOSPHORYLASE_2
Definition
UDPase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os02t0117700-01 (Os02g0117700)
   00052 Galactose metabolism
    Os02t0117700-01 (Os02g0117700)
   00500 Starch and sucrose metabolism
    Os02t0117700-01 (Os02g0117700)
   00520 Amino sugar and nucleotide sugar metabolism
    Os02t0117700-01 (Os02g0117700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Os02t0117700-01 (Os02g0117700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr02:complement(join(929810..929868,929656..929703,929354..929536,929177..929237,929002..929079,928874..928924,928721..928794,928556..928628,928403..928460,928244..928290,928100..928165,927899..927931,927755..927807,927596..927671,927462..927518,927298..927381,927129..927227,926928..927032,926637..926708,926333..926359))
AA seq 467 aa AA seqDB search
MADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDT
LAAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYTNSNIEVHTFNQSQYPRVVADEFLPWPSKGKT
CKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTL
KVSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagctcgccaagctgcgtgaagccgtcgccggcctctcgcagatcagt
gacaacgagaagtccgggttcatcagcctcgtcgcccgctacctcagtggcgaggaggag
catgtggaatgggcaaagatccacacgccgacggacgaggtggtggtgccgtacgacacc
ctggcggcgccgccggaggacttggaggagaccaagaagctgctcaacaagctcgccgtg
ctcaagctcaacggcggcctcggcaccaccatgggatgcaccggaccaaaatcggtcatc
gaagtgcgcaacggattcacattcctcgacttgattgtgatccagatcgagtccctcaac
aagaagtatggcagcaatgtcccactgcttctgatgaactcattcaacacccatgaagac
accttgaagattgttgagaaatacaccaattcgaacattgaagtccatactttcaatcag
agccagtatcctcgtgtggtagccgatgagttcttgccatggccttccaaggggaagacc
tgcaaggatggctggtaccctcctggccatggtgatatcttcccatccctgatgaacagt
ggcaagcttgatttgttactttcacagggaaaggagtatgtgttcattgcaaactcagat
aacttgggtgctatagtggacatgaagatactgaaccatttgatccacaaacagaatgaa
tattgcatggaggttaccccgaaaactctggctgatgttaaaggtggcacactgatctca
tatgaagacaaggttcagctcctggagattgcacaagttcctgatgcacatgtgaatgaa
ttcaaatccatcgagaaattcaagatcttcaacacgaacaatctatgggtgaacttgaag
gctatcaagcgccttgttgaggctgatgcactaaagatggagatcattccaaaccctaag
gaagtggatggagttaaagttcttcagttggaaacagcagctggtgcagcaatcaggttc
tttgatcacgcaattggtatcaatgttccaaggtcccggttcctaccagtgaaggcaaca
tcagatttgcagctagtacagtctgatctatataccttggttgatggctttgttacacgc
aacccggccagaacaaacccatcgaatccctcaattgaactgggtccagagttcaagaag
gtcgggtgtttccttggtcgcttcaagtcaatccccagcattgttgagcttgacaccttg
aaggtttccggtgatgtttggtttggctctagcatcacattgaagggcaaggtgaccatc
acagcccaacctggtgtcaaactggaaatcccagatggagcagtgatcgagaacaaggat
atcaatggccccgaggacctttga

DBGET integrated database retrieval system