KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0122300-01Help
Entry
Os02t0122300-01   CDS       T02163                                 

Gene name
Os02g0122300
Definition
Translation initiation factor eIF3 subunit domain containing protein.
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os02t0122300-01 (Os02g0122300)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Os02t0122300-01 (Os02g0122300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(1176773..1176785,1175647..1175768,1175005..1175156,1174673..1174823,1174429..1174588,1174224..1174321))
AA seq 231 aa AA seqDB search
MEDWDSEDFQPAVPSAKAEPLKSKWADEDVEEDDVKESWEEEEEEKPKPPPVEKTAPKPS
GKGAAKKGKQQASTSSEVVQDEALDDPALEKLRQQRLVEEADFKSTTELFGKKDGSEKSL
DTFIPKSESDFAEYAELIANKLRPYEKSFHYMGLLKNVMRLSMASLKGADAKDISSSIAA
IANEKIKAEKEAAAGKKKQGAKKKQLHIENKDDDFIPGKGNFDDPDEYDFM
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaggactgggattctgaagactttcagcccgcagtgcctagtgcaaaagctgagccg
cttaaaagtaagtgggcagatgaagatgtggaagaagatgatgtaaaagaatcatgggaa
gaagaggaggaggagaaacctaaaccaccacctgtagaaaagactgcaccaaaacctagt
gggaaaggtgctgcgaagaaaggaaaacaacaagcatcaactagttctgaagtagttcaa
gatgaggctctggatgatcctgctctagagaaacttcgtcaacaaaggcttgtggaagaa
gctgactttaagtcaactacggaactttttggaaagaaggacggcagtgaaaagtcccta
gataccttcatcccaaagtctgagagtgactttgcggaatatgcagagcttattgcaaac
aaactgcgtccctatgagaaaagcttccactatatgggtctactcaagaatgtcatgaga
ctttccatggcatcattgaaaggtgcggatgcgaaagatatatcgtcctccattgcagca
attgctaatgaaaagatcaaggctgagaaagaagctgcagcaggcaaaaagaaacaaggg
gcaaaaaagaagcagctacacattgagaataaagacgatgatttcatccctggaaagggt
aattttgatgatccggatgagtacgatttcatgtga

DBGET integrated database retrieval system