KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0137500-01Help
Entry
Os02t0137500-01   CDS       T02163                                 

Gene name
Os02g0137500
Definition
Similar to histone acetyltransferase.
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:join(1991843..1992013,1993070..1993198,1993291..1993491,1993651..1993793,1993878..1994190,1994349..1994488,1995320..1995398,1995484..1995869,1996204..1996425,1996521..1996632)
AA seq 631 aa AA seqDB search
VEEVKRGLRMPLPQSAVLGAKDLPRTVLSDHIEDRLFKRLKQERQDRAAQERKSIEEVPG
AEGLVVRVVSSVDKKLEVKPRFLEIFQEDNYPTEFPYKSKAVLLFQKIEGVEVCLFGMYV
QEFGAECSYPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKQRGFT
SCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKATKEEIVVELTNLYDHFF
ITMGECKAKVTASRLPYFDGDYWPGAAEDMINQLRQEEDDRKQQKKGKTKKIITKRALKA
AGHTDLSGNASKDAMLMHKLGETIYPMKEDFIMVHLQYSCSHCCTLMVSGKRWVCHQCRS
FYICDKCYDAEQQLEDRERHPSNSRDTHTLHPVDIVGLPKDTKDRDDILESEFFDTRQAF
LSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCCHDIETGQGWRCEVCPD
FDVCNSCYQKGAVNHAHKLTNHPSAADRDAQNKEARQMRVQQLRKMLDLLVHASTCRSGS
CQYPNCRKVKGLFRHGMQCKTRASGGCVLCKKMWYMLQLHARACRDSGCNVPRCRDLKEH
LRRLQQQSDSRRRAAVNEMMRQRAAEVAANE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gttgaagaggtgaaacgtgggttgcgtatgcctctaccacagagtgcagttcttggggca
aaagatctgcctagaactgtactaagcgatcatattgaagatcggctttttaaacggttg
aagcaggagagacaggatagggcagctcaggagaggaaaagcattgaggaggttcctgga
gccgaaggtcttgtggttagagttgtttcatcagtggacaagaagctggaagtaaaacca
cgttttttggaaatttttcaagaagataactacccgacagagttcccatacaagtccaag
gctgtccttttgttccagaaaatagaaggtgtagaagtgtgcctatttggaatgtatgtt
caagaatttggtgcagaatgctcctacccgaaccagcgtcgtgtttatttgtcatacctg
gattctgttaaatacttcaggcctgagattagaacggtgtctggagaggcgttacgtaca
tttgtttatcatgaaattctgataggatatcttgaatattgcaagcagcgtggattcaca
agctgttacatatgggcgtgcccacctttaaaaggtgaagattacattttgtactgccat
cctgagattcagaagactccaaaatccgacaaattgagggagtggtacttatctatgctt
cgaaaagctaccaaggaggagattgttgttgagctgacaaatctatatgaccatttcttc
attactatgggggagtgcaaggctaaagtgactgcttctcgtttgccttactttgatgga
gattattggccaggagctgcagaagatatgatcaatcaacttcgtcaagaagaagatgac
cggaagcagcagaagaagggcaagacaaagaagattattacaaaaagagctcttaaagct
gctggccacaccgatctcagtgggaatgcttccaaggatgctatgctgatgcacaagctt
ggggaaaccatttatccaatgaaggaagatttcattatggttcatttgcagtattcgtgt
agtcactgttgtacccttatggtgtctggaaaacgttgggtttgccatcaatgcagaagc
ttttacatatgcgacaagtgttacgatgcagaacaacagcttgaagatagggagaggcac
ccaagtaacagtagagacacacatacgctccatccggttgacattgttgggttgcccaaa
gataccaaggatagagatgatattctggaaagtgaattttttgacaccaggcaggccttc
cttagtctctgtcaaggaaatcattatcagtacgatacccttcgccgtgctaagcactca
tcgatgatggtgttgtaccatctacataatccaaccgcaccagcgtttgtcactacatgc
aacgtctgctgtcatgatattgaaactggtcagggttggcggtgtgaagtctgtccagat
tttgatgtatgcaattcttgttaccaaaaaggagcagtcaatcatgctcacaagttaaca
aaccatccatcagctgctgatcgtgatgcccaaaataaggaagctcggcaaatgcgtgtc
cagcagctaaggaagatgcttgatcttctggtacatgcctcgacatgccgctctggcagt
tgtcaatacccaaactgccggaaagtcaagggactgtttcgtcatgggatgcagtgcaaa
acacgtgcttcaggagggtgtgttctttgcaagaaaatgtggtacatgctccagctccat
gcccgagcttgcagggactcaggatgcaacgtgccgagatgcagggatctcaaggagcat
cttcgaaggttgcaacagcaatctgattctaggaggagggctgctgtaaatgaaatgatg
agacagagagcagcagaagttgctgcaaacgagtag

DBGET integrated database retrieval system