KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0137500-01Help
Entry
Os02t0137500-01   CDS       T02163                                 

Gene name
Os02g0137500
Definition
Similar to histone acetyltransferase.
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Os02t0137500-01 (Os02g0137500)
Transcription factors [BR:dosa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Os02t0137500-01 (Os02g0137500)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Os02t0137500-01 (Os02g0137500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:join(1991843..1992013,1993070..1993198,1993291..1993491,1993651..1993793,1993878..1994190,1994349..1994488,1995320..1995398,1995484..1995869,1996204..1996425,1996521..1996632)
AA seq 631 aa AA seqDB search
VEEVKRGLRMPLPQSAVLGAKDLPRTVLSDHIEDRLFKRLKQERQDRAAQERKSIEEVPG
AEGLVVRVVSSVDKKLEVKPRFLEIFQEDNYPTEFPYKSKAVLLFQKIEGVEVCLFGMYV
QEFGAECSYPNQRRVYLSYLDSVKYFRPEIRTVSGEALRTFVYHEILIGYLEYCKQRGFT
SCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKATKEEIVVELTNLYDHFF
ITMGECKAKVTASRLPYFDGDYWPGAAEDMINQLRQEEDDRKQQKKGKTKKIITKRALKA
AGHTDLSGNASKDAMLMHKLGETIYPMKEDFIMVHLQYSCSHCCTLMVSGKRWVCHQCRS
FYICDKCYDAEQQLEDRERHPSNSRDTHTLHPVDIVGLPKDTKDRDDILESEFFDTRQAF
LSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCCHDIETGQGWRCEVCPD
FDVCNSCYQKGAVNHAHKLTNHPSAADRDAQNKEARQMRVQQLRKMLDLLVHASTCRSGS
CQYPNCRKVKGLFRHGMQCKTRASGGCVLCKKMWYMLQLHARACRDSGCNVPRCRDLKEH
LRRLQQQSDSRRRAAVNEMMRQRAAEVAANE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gttgaagaggtgaaacgtgggttgcgtatgcctctaccacagagtgcagttcttggggca
aaagatctgcctagaactgtactaagcgatcatattgaagatcggctttttaaacggttg
aagcaggagagacaggatagggcagctcaggagaggaaaagcattgaggaggttcctgga
gccgaaggtcttgtggttagagttgtttcatcagtggacaagaagctggaagtaaaacca
cgttttttggaaatttttcaagaagataactacccgacagagttcccatacaagtccaag
gctgtccttttgttccagaaaatagaaggtgtagaagtgtgcctatttggaatgtatgtt
caagaatttggtgcagaatgctcctacccgaaccagcgtcgtgtttatttgtcatacctg
gattctgttaaatacttcaggcctgagattagaacggtgtctggagaggcgttacgtaca
tttgtttatcatgaaattctgataggatatcttgaatattgcaagcagcgtggattcaca
agctgttacatatgggcgtgcccacctttaaaaggtgaagattacattttgtactgccat
cctgagattcagaagactccaaaatccgacaaattgagggagtggtacttatctatgctt
cgaaaagctaccaaggaggagattgttgttgagctgacaaatctatatgaccatttcttc
attactatgggggagtgcaaggctaaagtgactgcttctcgtttgccttactttgatgga
gattattggccaggagctgcagaagatatgatcaatcaacttcgtcaagaagaagatgac
cggaagcagcagaagaagggcaagacaaagaagattattacaaaaagagctcttaaagct
gctggccacaccgatctcagtgggaatgcttccaaggatgctatgctgatgcacaagctt
ggggaaaccatttatccaatgaaggaagatttcattatggttcatttgcagtattcgtgt
agtcactgttgtacccttatggtgtctggaaaacgttgggtttgccatcaatgcagaagc
ttttacatatgcgacaagtgttacgatgcagaacaacagcttgaagatagggagaggcac
ccaagtaacagtagagacacacatacgctccatccggttgacattgttgggttgcccaaa
gataccaaggatagagatgatattctggaaagtgaattttttgacaccaggcaggccttc
cttagtctctgtcaaggaaatcattatcagtacgatacccttcgccgtgctaagcactca
tcgatgatggtgttgtaccatctacataatccaaccgcaccagcgtttgtcactacatgc
aacgtctgctgtcatgatattgaaactggtcagggttggcggtgtgaagtctgtccagat
tttgatgtatgcaattcttgttaccaaaaaggagcagtcaatcatgctcacaagttaaca
aaccatccatcagctgctgatcgtgatgcccaaaataaggaagctcggcaaatgcgtgtc
cagcagctaaggaagatgcttgatcttctggtacatgcctcgacatgccgctctggcagt
tgtcaatacccaaactgccggaaagtcaagggactgtttcgtcatgggatgcagtgcaaa
acacgtgcttcaggagggtgtgttctttgcaagaaaatgtggtacatgctccagctccat
gcccgagcttgcagggactcaggatgcaacgtgccgagatgcagggatctcaaggagcat
cttcgaaggttgcaacagcaatctgattctaggaggagggctgctgtaaatgaaatgatg
agacagagagcagcagaagttgctgcaaacgagtag

DBGET integrated database retrieval system