KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0180100-01Help
Entry
Os02t0180100-01   CDS       T02163                                 

Gene name
Os02g0180100
Definition
Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 family protein.
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os02t0180100-01 (Os02g0180100)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Os02t0180100-01 (Os02g0180100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(4457302..4457332,4456569..4456615,4456179..4456225,4456002..4456101,4455154..4455918))
AA seq 329 aa AA seqDB search
MSWAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDE
RPIKDPIPNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKGLA
IVNSESIRLASNSFARPEVPEEQKSSVKDDDVYHFISYVPVDGVLYELDGLKEGPISLGK
CPGGVGDIGWLRMVQPVIQERIDRFSQNEIRFSVMAILKNRREKFTLELKELQRKRENLL
AQMGDPSANRHAPSVEHSLAEVAAHIEAVTEKIIMEEEKWKKWKTENIRRKHNYVPFLFN
FLKILEERQQLKPLIEKAKQKSHSSANPR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctgcaatcgagaatgatcctggcatttttactgaactgttgcaacagatg
caactgaagggtcttcaagttgatgaactctattcactcgatctggatgccctcaatgat
cttcagccagtttatgggctcattgtgctgtacaaatggcaacctccagaaaaagatgag
cgtcctatcaaggacccaatcccaaaccttttctttgctaagcagataattaacaatgca
tgtgccacccaagctatcgtttctgttctattaaactctccgggtatcacccttagtgag
gagctcaaaaagctaaaggagtttgcaaaggacttgccaccagatctcaaaggattggct
atagtcaattctgagagcatccgtttggccagtaattcatttgcaaggccggaagtcccc
gaggagcagaaatcatctgtcaaggatgatgatgtctaccatttcattagctatgttcct
gtggacggtgtcctgtatgagcttgatgggctaaaggaagggccaataagcctggggaaa
tgcccaggtggcgttggcgacataggttggctgaggatggtgcagcctgtcattcaggaa
cgcatcgatcggttctctcagaatgagataaggttcagcgtcatggctatcctaaagaac
cggagggagaagttcactttagaactcaaggagcttcagaggaagagggagaacctcctg
gcacagatgggtgatccttccgccaataggcacgcgccatctgttgagcactctcttgcg
gaggttgctgctcatattgaggctgtaacagagaagatcataatggaggaagagaagtgg
aagaagtggaagacagagaacatcaggaggaagcacaactatgtgccattcttgttcaat
ttcctcaagattcttgaggagaggcagcagttgaagcccctgatagagaaggcgaaacag
aagtctcacagctctgctaatcctaggtga

DBGET integrated database retrieval system