KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0202250-01Help
Entry
Os02t0202250-01   CDS       T02163                                 

Gene name
Os02g0202250
Definition
(RAP-DB) Hypothetical conserved gene.
  KO
K14310  
nuclear pore complex protein Nup205
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os02t0202250-01 (Os02g0202250)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Os02t0202250-01 (Os02g0202250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(5724412..5724563,5724224..5724343,5723837..5723957,5721966..5722163,5721759..5721877,5721486..5721636,5721288..5721400,5721135..5721216,5720966..5721052,5720801..5720878,5720544..5720726,5719562..5719654,5719383..5719496,5719142..5719300,5719001..5719056,5718842..5718914,5718551..5718741,5718313..5718445,5718165..5718242,5717545..5717709,5716650..5716820,5716438..5716572,5713889..5714032,5713694..5713816,5713504..5713596,5711618..5711743,5711321..5711421,5710542..5710661,5710374..5710449,5710002..5710085))
AA seq 1212 aa AA seqDB search
MEECVWQIYDMRFELNEVEAMRESYPSTISFLNLVNALIAEERNISDKGRRFMGIFKFVY
EDVFGPFPQRAYADPREKWELAVACLEHFRMVLSMYDIKDDDIYAAVNASGPSTTSHASI
DRQLPVLELLKDFMSGKVAFRNIMNIVSVGVDTLINERTTQTYGILLEKTVHLSFEIFIL
VMERDLVLADVFRPLYQPLDVVLAQNHRHIIALLEFVRYDYLPQIQQCSIKIMGILSSRI
VGLVQLLLKADVAKSVIEDYAACLEFRFDDFQAIENTKDDVGVLILQLLIDNICRPAPNI
THLLLRFDVNGSIERTVLKPKSHYSCLKTILDNLEKVTKPDINALLHEFGFQLLYELCLD
PLTCGPVMDLLSTTKYQFFSKHVGTIGVSPLPRRNNNQSLRISMLHERAWLLKMLALALH
VSDISSSLYRESCLAILCHTFGHCAENLRSANLLQSPGSSNLAMNGNKVLDLLEVVQFRC
PDTSIKYPQMLSNLRLESKIEEILRNSATSEFGGVYYYSERGDRLIDLDAFHEKLLQMSQ
LLNPQLSESEKSELKESFHQMLKWAWRYNKNLEEQAAQLHMLTGWSQIVEIAVSRRMSLL
EDRSHLLFELLDASLSATTSPDCSVKMAYILTNVALTCMAKLRDERFICPTGADSDAVTC
LDIISAKQLSNAACTSLLFKLTMAILRNESSETLRRRQYALLLSYFQYCRSTLDSDVPPP
VLRFLLLEEQEGDDDELGLQKVLKEQNELARSNFSIIRKEAQAVIDLVAKDAIHGSEAGK
AISFYVLDSLISIDHDKYFLNQIQSRGILRSCLSDVNNYLSKEASFSSESSQRFCTIDAQ
LSLLLRISHHYGKHGSQILLSMGALHNLSSCNLMGSQKKANSRLNSNVVKERAGEIDKRR
SLTAPILRIVTSFTSLVDSADFLEVKNKIVRELVDFAKQHQPVFNIILRESISGANIFNL
ERLNMVVSILGKVWAYEENDECSFVQDLFSMMQFLFSLDIGSLNFMQSSNMIENQKSELI
VFALCFSLISYLYVLATKKDMRFQISYDDTTEGQQQPTLQLISDLLNSITVAMERVAEEK
YMLLNKIRDLNELSRKEVDDIIKLCMKQDCISPNDNIRKRRFIAMIELCCMAGNRGQLIT
LLLQIAECAVTILLVHFQDESCAKDISSFSDELLPILERLEHFTEDKVGRSLKLFHRSVT
TLKEMTIRSMSL
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatgtgtttggcagatctatgacatgaggtttgagttgaatgaagttgaagca
atgagggagagttatccatccacaatatcatttctcaacttagtcaatgctctaattgca
gaagaaagaaacataagtgacaagggccggaggtttatgggtatatttaagtttgtttac
gaagatgtatttgggcctttccctcaaagagcctatgccgatcctcgggagaagtgggaa
ctggcagttgcttgcttggagcacttccgcatggttttaagcatgtatgacatcaaggat
gatgatatttatgctgctgttaacgcatctggaccttcaacaacatctcatgcctcaatc
gacagacagctccctgtgcttgagctactcaaagatttcatgagtgggaaagttgctttc
cggaatattatgaacatcgtatcagtgggtgtggacactcttattaatgagcgaactacc
caaacttatgggattcttctggagaaaactgtccatctatcatttgaaatatttattctt
gtgatggagagagatctggtgcttgctgatgttttccgtccactctaccagccgttggat
gttgtgttagctcagaatcatagacatattatagctttactggagtttgtacgatatgat
tatcttcctcagattcaacagtgctctataaaaattatgggaattctgagttctagaata
gttggtcttgtccagttgcttctgaaagcagatgttgctaaatcggtaattgaggattat
gctgcttgcttggagttccgctttgatgatttccaggccatagagaacacaaaagatgac
gttggtgtcctaatactacagctacttatcgacaatatttgtcgtccagctcccaacatt
acacatctactcctaagattcgatgtcaatggatccatagaacggacagttttaaaacca
aagtcacactacagttgtttaaagacaattcttgacaatcttgaaaaggtgacaaagcca
gatataaatgctttactgcatgaattcggttttcagcttctctacgagttatgccttgac
cctttaacttgtgggcctgtcatggatctcctgagcacaacaaaataccagttcttttct
aagcatgttggaaccattggtgtgtcaccacttccgagaaggaacaacaatcaatctctt
cgtattagcatgctccatgagagggcatggttgctaaagatgctagcattggcattgcat
gtatctgatatatcatcgtccttataccgggagtcctgtttggctattctatgtcatact
tttggccattgtgctgagaacttaaggagtgcaaacctgttacaatctcctggcagtagc
aatttagcaatgaatggaaacaaggttttggatttgcttgaagttgtccagttcagatgt
ccggacacttccattaaatacccccagatgctttctaacctgagacttgaatcaaagatt
gaagagatcctaaggaattccgcgacatctgaatttggtggtgtatattattattcagag
cgaggcgatagattgattgatcttgatgcatttcatgaaaaacttctccagatgtctcag
ttattgaacccacaattaagtgaatctgagaaaagcgagctaaaagaatcattccatcag
atgctgaaatgggcctggagatataacaaaaatcttgaagaacaagcagcccagcttcac
atgttgactggctggtctcaaattgttgaaatagcagtatctagaaggatgtcattactt
gaagatcgttctcatttattgtttgagctccttgacgcttcattaagtgccacaacatct
ccagattgttcagtgaaaatggcatatattttaaccaatgtggcattgacttgtatggcg
aaactgcgggatgaaagattcatatgcccaaccggtgccgattctgatgcagttacttgc
cttgacatcatttcagcaaagcagttgtcaaatgcagcctgcacttcattattgttcaaa
ctcacgatggcaatactaagaaatgaatcttctgagaccttgagaagacgccaatatgca
ttactgttaagttattttcagtactgccgtagcacccttgactctgatgtccctccacca
gttcttcggttcttactacttgaagaacaagagggagatgatgatgaacttggtcttcaa
aaggttctcaaggaacaaaatgaattagcacgcagcaacttctctatcataaggaaggaa
gctcaagcagttattgatttggttgccaaggatgcgatccatggaagtgaagcagggaaa
gcaatttcattctacgttcttgattcactgattagtattgaccatgacaagtattttttg
aaccaaattcagagtcgaggaattctcagatcatgtctaagtgatgttaacaactacttg
tctaaggaagcatcattctcatcagagtcttcacagcgattttgcactattgatgctcaa
ttgtcattacttctgagaatcagtcaccactatgggaaacatggctcccagattctgttg
tccatgggtgctctacataatctttcgtcgtgcaacctgatgggttcgcagaaaaaggca
aattcaaggctcaactccaatgtagtgaaagagcgagctggagaaattgacaagaggaga
tcacttactgcaccgatacttagaatagtcacatctttcacctcacttgtggactccgct
gattttcttgaggtgaagaacaaaattgtccgggagttagtagacttcgccaagcagcat
cagcctgtttttaatatcattttaagagagagtatatctggagctaatatattcaacttg
gagcggcttaatatggtggtctctattcttggcaaggtatgggcatatgaggaaaatgat
gaatgcagctttgtccaagatctattttccatgatgcaatttcttttcagtcttgatatt
gggtctctcaactttatgcaatcatcaaacatgattgagaatcagaagtcagaattgata
gtgtttgccttgtgcttcagccttatctcctacctatatgttctggctacaaagaaggat
atgcggtttcaaatttcgtatgatgatactactgaaggtcagcagcaaccaacactacaa
ctgatttcagatcttctaaactcaataacagttgctatggaaagagtagctgaagaaaaa
tatatgttgctaaataagattcgtgacttaaatgagttatctaggaaggaggttgatgat
ataataaaattatgcatgaaacaagattgtatctctcccaacgataacatccgtaaaagg
aggttcattgcaatgatagaattgtgttgcatggccggcaaccgaggccagctcataacc
cttctactccaaatcgcagaatgcgctgtcactattctccttgttcattttcaagacgag
tcttgtgcaaaagatatttcttcattttctgatgagttgcttcctatcctggagaggcta
gagcattttacggaggacaaggtcgggcgtagcctcaagctatttcaccgatctgtaacc
actctaaaagagatgaccatcagaagcatgtcattgtga

DBGET integrated database retrieval system