KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0202300-01Help
Entry
Os02t0202300-01   CDS       T02163                                 

Gene name
Os02g0202300
Definition
Protein of unknown function DUF3414 domain containing protein.
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dosa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(5731961..5732110,5731752..5731847,5730652..5730726,5730460..5730564,5730264..5730374,5729459..5729618,5729202..5729284,5728969..5729091,5728624..5728848,5727721..5727810))
AA seq 406 aa AA seqDB search
MPPPPPPRELLAVVEAALLGPSPPSPAQRVELLHAVRDAAPAFRALLSYPGPKASDRTQV
EAKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVDANREWVLYGREPLEIYR
LAAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFIEGLGQRIITLVKE
LNREESTGVGQPSSEHYVLDFRGALVERRAIVSRERLSLSHCLALSALIKLMSPREVKDV
FSLLKDCAAEVNENSSVELQITYGVLFSLVVTFVSDALSTSHEKPSLSSSDSSFRRDFHE
LVMRSDNNLTIEGFVGVVRLAWAVHLMLTQDRSSARDTLTSSSRDVTDIWACLEIICRQN
SFQFLQERIMQTAAYKNDDEDIVYMYTGYMHKLMMCFLSHPTSRDK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgcccccgccgcgcgagctcctggccgtcgtcgaggcggcgctgctcggg
ccatccccgccgtcgccggcgcagcgcgtggagctcctccacgccgtccgcgatgccgcc
cccgcattccgcgcgctcctctcctacccggggccgaaggcgtcggatcggactcaggtg
gaggccaaggaagtgcggctcccggacatgcctcccataacgctcgatgacaccgacgtg
cagacggccctgaaattgagtgatgaactcaatcttaatgagattgagtgtgttcgattg
ctagttgacgccaacagggagtgggttctatatggccgagagccactggaaatatatagg
ctcgcagctggcctttggtacatggagagaagggatcttataacctctttgtacattctg
ttacggtctgttgtacttgaccaagggcttgatgctgatctgatgtatgaaatacaaaac
caaatggaggctctatttattgagggtctcgggcagcgtataattacactagtaaaggaa
cttaatcgtgaagaatcaactggtgttggccaaccaagctctgagcattatgtgcttgat
ttcagaggggctcttgtggagaggcgtgccattgtttctcgcgagagattaagtttgagc
cactgccttgctctttctgcacttattaaattgatgagtcccagggaggttaaggatgta
ttttcattgttaaaagactgtgcagctgaagttaatgaaaattctagcgtggagcttcag
atcacctatggcgttcttttttctcttgtagtaacttttgtttctgatgccttaagtact
tcccatgagaaaccatctttgtcatcttccgattcttcgttcaggcgtgattttcatgag
ctggtgatgaggtcagataacaatttgactattgaaggatttgttggtgttgtgcgactt
gcatgggcagttcatttgatgttaactcaagatcgaagcagtgcaagagatactctcact
agttcttcgagagatgtgacagatatatgggcatgtctggagataatctgtcgccagaat
agttttcaatttttgcaggaacgtattatgcaaacagctgcctacaagaatgacgatgag
gacattgtttacatgtacactggctacatgcacaagttgatgatgtgctttctttcccat
ccaacttctagagacaag

DBGET integrated database retrieval system