KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0202300-01Help
Entry
Os02t0202300-01   CDS       T02163                                 

Gene name
Os02g0202300
Definition
(RAP-DB) Protein of unknown function DUF3414 domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(5731961..5732110,5731752..5731847,5730652..5730726,5730460..5730564,5730264..5730374,5729459..5729618,5729202..5729284,5728969..5729091,5728624..5728848,5727721..5727810))
AA seq 406 aa AA seqDB search
MPPPPPPRELLAVVEAALLGPSPPSPAQRVELLHAVRDAAPAFRALLSYPGPKASDRTQV
EAKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVDANREWVLYGREPLEIYR
LAAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFIEGLGQRIITLVKE
LNREESTGVGQPSSEHYVLDFRGALVERRAIVSRERLSLSHCLALSALIKLMSPREVKDV
FSLLKDCAAEVNENSSVELQITYGVLFSLVVTFVSDALSTSHEKPSLSSSDSSFRRDFHE
LVMRSDNNLTIEGFVGVVRLAWAVHLMLTQDRSSARDTLTSSSRDVTDIWACLEIICRQN
SFQFLQERIMQTAAYKNDDEDIVYMYTGYMHKLMMCFLSHPTSRDK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgcccccgccgcgcgagctcctggccgtcgtcgaggcggcgctgctcggg
ccatccccgccgtcgccggcgcagcgcgtggagctcctccacgccgtccgcgatgccgcc
cccgcattccgcgcgctcctctcctacccggggccgaaggcgtcggatcggactcaggtg
gaggccaaggaagtgcggctcccggacatgcctcccataacgctcgatgacaccgacgtg
cagacggccctgaaattgagtgatgaactcaatcttaatgagattgagtgtgttcgattg
ctagttgacgccaacagggagtgggttctatatggccgagagccactggaaatatatagg
ctcgcagctggcctttggtacatggagagaagggatcttataacctctttgtacattctg
ttacggtctgttgtacttgaccaagggcttgatgctgatctgatgtatgaaatacaaaac
caaatggaggctctatttattgagggtctcgggcagcgtataattacactagtaaaggaa
cttaatcgtgaagaatcaactggtgttggccaaccaagctctgagcattatgtgcttgat
ttcagaggggctcttgtggagaggcgtgccattgtttctcgcgagagattaagtttgagc
cactgccttgctctttctgcacttattaaattgatgagtcccagggaggttaaggatgta
ttttcattgttaaaagactgtgcagctgaagttaatgaaaattctagcgtggagcttcag
atcacctatggcgttcttttttctcttgtagtaacttttgtttctgatgccttaagtact
tcccatgagaaaccatctttgtcatcttccgattcttcgttcaggcgtgattttcatgag
ctggtgatgaggtcagataacaatttgactattgaaggatttgttggtgttgtgcgactt
gcatgggcagttcatttgatgttaactcaagatcgaagcagtgcaagagatactctcact
agttcttcgagagatgtgacagatatatgggcatgtctggagataatctgtcgccagaat
agttttcaatttttgcaggaacgtattatgcaaacagctgcctacaagaatgacgatgag
gacattgtttacatgtacactggctacatgcacaagttgatgatgtgctttctttcccat
ccaacttctagagacaag

DBGET integrated database retrieval system