KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0244300-01Help
Entry
Os02t0244300-01   CDS       T02163                                 

Gene name
Os02g0244300
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os02t0244300-01 (Os02g0244300)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os02t0244300-01 (Os02g0244300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(8136374..8136696,8137068..8137458,8137541..8137928,8138018..8138172,8138264..8138352,8138524..8138609,8138706..8138868,8139947..8140070,8140325..8140482,8140574..8140658,8140995..8141207,8142215..8142276,8142367..8143057)
AA seq 975 aa AA seqDB search
MLQPRESDVPVLFVVFIVLPVIAYFLLGRWHDAVSKKARVSVLAQRAAEETFKVETMATP
DVILPGPSLRPMPYMRSAPSARPEYHECATCHGPAKTRCSRCKSVRYCSGKCQIIHWRQG
HKQTCQQWNGFGTSSSGGLPPTENTEQMPFLSNLNSPLRGSDVHLHDMDFDTMSEPSFVT
TDSYNLDTSPFLSDRSNMNKPNQFLHTSENGAAIGSYEKNDYSIDGEVPSSEILSGNKGL
NNSSGSGENCGNRDVIYPLNSVVHQPNNYAPEIRKRPKASITVYESDKGVYLTSDMISSG
EGPYASAAESLQRSNSSGNVTGKGNMIHKKPPYPSGKVSSSQKSQEKVLTSHQYDGHEKN
PHNKNEQRSTKTAVSTNSSLQGCNGISKAGASKVEALKKPSKFLKTSLVGLINDNKRSKV
LFPYEDLVKFFQYEVRGISPRGLFNCGNSCYANAVLQCLMCTKPLMIYLLLRLHSKDCCS
KNWCLMCELEQYASTLRESGGPVSPSRILSNLRNIGCRLGGGSQEDAHEFLRHLVMSMQG
ACLDGLGGEKQVEASLQETTLIQQMFGGRLKSKVKCLRCYHESERYENIMDLTLEIHGWV
ESLQDALTQFTAPEDLDGENMYKCGRCSAYVKARKQLSVHEVPNILTVVLKRFQTGKYGK
INKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKDMQGTWLR
IDDSEVQAVSLNQVMSEGAYMLFYMRSFPRPPKIYIEKGLSSVPTCSKRHSSKSSKGSKQ
DLNHTESLFASSDQTYGIYDFRPDNGYIQDQHAALRTRNFYHTDDAFADSISTDFSDATS
SEWSLFTSSDESSFTTESTRDSFSVVDYGDNAGLDPISSIFGPYYAQDHPPGSFASCTRL
SPSNPQTRYFQENTGFVSDSSMPAHLPGNVHRGRYPDRACSSSAEPPASANPRSVYGRYG
LSREGFVQTSGFCQM
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaccaagggaatccgatgtgcctgtactatttgttgtatttattgtacttccg
gtgatagcttattttcttcttggaagatggcatgatgctgtaagtaagaaggcacgggta
agtgtgctggcccagcgagctgcagaagaaaccttcaaggtggaaacaatggcgactcca
gacgttatattgccaggaccttctttaagacccatgccttatatgagatctgcaccttct
gcaagacccgaataccatgagtgtgctacttgccacgggcctgctaagactcgctgctcc
agatgcaagtctgttagatactgctctggaaagtgtcaaataattcactggaggcaaggt
cataagcaaacatgtcagcaatggaatggttttggtactagcagctctggtggactacct
cctactgagaatactgaacagatgccattcttaagtaacctgaactcacctcttcgaggg
agcgatgttcatctgcatgacatggatttcgataccatgtcagagccatcctttgtgaca
acagatagctataatcttgataccagcccatttctgtcagaccgaagcaacatgaataaa
ccaaaccaatttctacatacaagtgaaaatggtgctgccattggatcttatgagaagaac
gactatagtattgatggagaagtcccttcttctgagattctgtcaggaaataagggttta
aataacagttctggttcaggtgaaaactgcggaaaccgtgatgtaatttatcctctcaat
agtgtggtacatcaacccaataattatgcccctgaaataagaaagcggcccaaagcaagc
atcacggtttatgaatctgataaaggcgtgtatttaacttctgatatgatcagttctggt
gaggggccatatgcttctgctgcagagtcactacaaagaagtaactcgtctggaaatgtt
accggaaaaggaaacatgatacataagaaaccaccatacccatctggtaaagtgtcatca
tcacaaaaatcacaggagaaggtgttgacatcacatcaatatgatgggcatgaaaagaat
ccccacaacaaaaatgagcaaagatctaccaaaacagctgtttcaacaaacagcagtttg
caaggatgcaatggcatctcaaaagcaggagcatcaaaggttgaagccctgaagaagcct
tcaaaatttctcaaaaccagtctggtgggtttgatcaatgataacaagaggagtaaggta
ctgttcccatatgaagatcttgttaagttttttcagtatgaagtacggggcatctcacct
agaggtcttttcaattgtggaaatagttgctatgcaaatgctgttctacaatgtctcatg
tgcacaaaacccctgatgatctatctgcttctgagactgcattccaaagactgttgctca
aagaattggtgcctcatgtgtgaacttgagcaatatgcttcaactttgcgtgaaagtggt
ggccctgtttctccaagtagaatcctttctaatctgaggaatattggatgtcgcttgggt
ggtggaagtcaagaagatgctcatgaatttttaaggcatcttgtgatgtctatgcaaggg
gcatgcctggatggacttggtggtgagaagcaggtagaagcaagcttgcaggaaactaca
ctgatacagcagatgtttggtggccgtcttaaatcgaaggttaagtgcctcagatgctac
catgaatctgaaagatacgagaatataatggatcttactttggagattcatggttgggtc
gagtccttgcaagatgctttgacacaattcactgctcctgaagatttggatggagaaaat
atgtataaatgtggaaggtgttctgcctatgtcaaagctaggaaacaattaagcgtgcat
gaggtgccaaatatattaactgtagttcttaaaagattccagacagggaaatatgggaag
atcaacaaatgtgttacttttcctgatatgttggacatggttccgtttgtgactggagct
ggtgataatcctcctctttacttcttgtatgccgtggttgtacacgtggatacagaaaat
gcatcattctctggacattacatatcatatgtcaaagatatgcagggcacatggttgaga
attgatgattcagaggtccaggctgtttcactgaatcaagttatgtcagaaggtgcatat
atgctgttctacatgagatcttttcctcgcccaccgaagatttacattgagaagggccta
tcatcagttcctacatgttcaaagcgccattcatcaaaatcctccaagggttctaagcaa
gacctgaatcatactgagtcactctttgcttccagtgatcaaacctatggaatatacgat
ttcagaccagacaacggctatatacaagatcagcatgctgctttgagaaccagaaatttc
tatcataccgatgatgcttttgcagattcaattagcacagacttctcagatgctacatca
agcgaatggtcactgtttaccagctctgatgaatcctcatttacgactgaaagcactaga
gattcattcagtgttgtggactatggtgacaatgctggccttgatccaatttcctctata
tttgggccttattatgctcaagaccatcctcctggcagttttgcctcgtgtacaaggttg
tcaccttccaatccacaaacaaggtacttccaagagaacacaggctttgtctcagattct
tccatgccggctcacctgcccggcaatgtacatagaggaagatatccagacagggcctgt
tcttcttcagctgaacctcctgcttcagcaaatccgcgaagcgtatatggtaggtatggc
cttagtagagaaggttttgttcaaacatctggattttgtcaaatgtaa

DBGET integrated database retrieval system