KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0274100-01Help
Entry
Os02t0274100-01   CDS       T02163                                 

Gene name
Os02g0274100
Definition
Similar to Peroxisomal fatty acid beta-oxidation multifunctional protein (MFP).
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Os02t0274100-01 (Os02g0274100)
  Lipid metabolism
   00071 Fatty acid degradation
    Os02t0274100-01 (Os02g0274100)
   00592 alpha-Linolenic acid metabolism
    Os02t0274100-01 (Os02g0274100)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Os02t0274100-01 (Os02g0274100)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Os02t0274100-01 (Os02g0274100)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Os02t0274100-01 (Os02g0274100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(10001646..10001742,10001854..10001925,10002688..10002750,10002854..10002910,10003061..10003128,10003229..10003310,10003419..10003474,10003836..10004138,10004540..10004626,10005356..10005530,10005715..10005836,10006073..10006236,10007103..10007357,10007881..10008002,10008122..10008243,10008354..10008502,10009083..10009221,10009673..10009720)
AA seq 726 aa AA seqDB search
MAGAIRVTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGG
KFCGGFDINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQGLALGGGLELTMG
CHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGL
VDALCSPDELIKMSRLWALEIANYRKPWIRSLARTDRLGSLSEARSVLNSARQQAKKVAA
NLPQHQACLDVMEEGVLCGGHAGVLKEAKVFKELVLSPTSKALVHAFFAQRLTTKVPGVT
DVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLEGLV
KRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPHCIL
ATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKMI
KKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVFRIDRVISSFGMPMGPFQLQDLAG
YGVALAVKDIYAAAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVV
IDEYRRCAKTMPGGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMG
FPKFRGGLVFWADTIGAPYIHSKLSKWTEIYGDFFKPSSYLEDRAKRSLPLSAPNATQQA
SSRSRM
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcgatccgcgtcaccatggaggtgggcgccgacggcgtcgcggtcgtcacc
atctgcaacccgcccgtcaatgcgctgcatcccatcatcatccagggattgaaggagaag
tacgcggaggcgatggatcgcgacgacgtcaaggccatcgtgctcaccggtgctggaggc
aaattttgtggaggctttgatatcaatgtgttcacagaagttcacaagactggaaatgta
tctcttatgcctgatgtatctgttgagcttgtgtcgaatttgatggaagcgggcaaaaag
ccttcagttgctgccattcaaggccttgctcttggtggcggtttggagttgaccatgggt
tgccatgctcggatatctacccctgaagctcaacttggactaccagagttgactctgggc
ataattcctggatttggaggaacccagcgtctgccaaggcttgtaggtctgcccaaagca
atagaaatgatgctgcaatcaaagttcatcacagcaaaggaagggaaagaaggtggtctt
gttgatgccctgtgctcccctgatgagttgataaagatgtcacgcctttgggctctggag
atagctaattaccgtaaaccttggataagatctcttgccagaacagataggcttggttca
ctgtctgaagctcgttctgtattaaatagtgcaagacagcaagcgaagaaggttgcagca
aacttgccacagcaccaggcctgcctagatgttatggaagaaggtgtactatgtggaggc
catgctggtgttctgaaggaggccaaggttttcaaggagttggtgctatcaccaacatca
aaggcacttgtacatgctttctttgcccagcgtttaaccacaaaggtgccaggtgttact
gatgttcaattgaaacctaggaaaataagaaaagttgctgttattggtggtggtttgatg
ggctctggaattgcaacagctcttcttgttagcaatacatccgttgtgcttaaggaagta
aatcctcaattcctgcaaaggggacagaagatgatagcagctaatcttgagggtctagtc
aagaggggctcattgacaaaggacaagatgaacaaggccatgtcacttctcaagggtgca
ttggattattctgatttcaaggatgttgatatggtcatcgaggctgtcatagagaagatt
cctttgaaacaatcaatattttctgaccttgagaaagtatgcccaccccactgcatactt
gcaacaaacacatctaccatcgatttgaatgttgtgggcgagaagacaaattctcaagat
agaattataggggcacatttctttagccctgcccatattatgcctttgcttgaaattgtc
cggacggagaagacatcaccgcaagctattcttgatctcatcacagttgggaaaatgata
aagaaagtccctgttgtggttgggaactgcacaggcttcgcagtcaatcgtacatttttc
ccttacacacagggttctcatcttctagttagtattgggatcgacgttttcagaattgat
cgagtaataagcagctttggcatgccaatgggaccttttcaactgcaagatctggctgga
tatggagtggcattggcagtaaaggatatctatgcggctgcctttggaacaaggaatctg
gactctaatctggtggatttgatggtacagaatggacggcagggaaagagcaatggtaaa
ggttattacctttatgagaagggtgggaagccgaagcctgacccaagtgttcaggttgtg
attgacgagtacagaagatgtgcaaagacaatgcctggtggaaagcctgttactttatct
gatcaagatatattggagatgattttcttcccagttgttaatgaggcatgcagggtcatg
gatgaaaatgttgtgatccgagcttctgatcttgatattgcttctatccttgggatgggt
tttcccaagttcaggggtggtcttgtcttttgggctgacactattggagcaccttatata
cattcaaagcttagcaagtggactgaaatttatggcgatttcttcaaaccatcatcctat
ttggaagatagagctaaaagaagcctaccattgagcgcaccaaacgcaacccagcaggct
tcgtcgaggtcacgcatgtga

DBGET integrated database retrieval system