KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0465400-01Help
Entry
Os02t0465400-01   CDS       T02163                                 

Gene name
Os02g0465400
Definition
Similar to 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC reductase) (Sterol delta-7-reductase) (Dwarf5 protein).
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    Os02t0465400-01 (Os02g0465400)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     Os02t0465400-01 (Os02g0465400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(15647090..15647226,15646749..15646974,15646481..15646536,15645324..15645426,15645167..15645232,15644818..15644931,15644472..15644598,15643138..15643238,15642885..15643010,15642732..15642796,15642531..15642612,15642373..15642455,15641711..15641777))
AA seq 450 aa AA seqDB search
MAKPRASAAAAKAPASTPPKTVHSALVTYASMLSLLSLCPPFVILLWYTMVHADGSVVRA
YEHLREHGVLEGLKAIWPMPTMAAWKIIFGFGLFEAALQLLLPGKRFEGPVSPSGNVPVY
KANGLQAYAVTLITYLSLWWFGIFNPAIVYDHLGEIYSALVFGSFVFCIFLYIKGHLAPS
SSDSGSSGNVIIDFYWGMELYPRIGKHFDIKVFTNCRFGMMSWAVLAVTYCIKQYEMNGR
VADSMLVNTALMLIYVTKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYL
VNHPVNLGPQLALSILLAGILCIYINYDCDRQRQEFRRTNGKCSIWGKAPSKIVASYQTT
NGETKSSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFDHFLPYFYVIFLTILLFDRAK
RDDDRCSSKYGKYWKMYCNKVPCRVIPGIY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcctagggcctccgccgccgcggcgaaggcgccagcctccacgccgcccaag
acggtgcactcggcgctcgtcacctacgcctccatgctctccctcctctccctctgcccg
cccttcgtcatcctcctgtggtacacgatggtgcacgcggacggatccgtggtgcgggcg
tacgagcacctccgcgagcacggggtgctggaggggctcaaggccatctggcccatgcca
accatggccgcctggaagatcatcttcggcttcggcctcttcgaggccgcgctgcagctt
ctcctccccgggaagcgcttcgagggccccgtctccccctcgggcaacgtgcccgtctac
aaggcaaatggcttacaagcatatgcagtgaccttgataacatacctgagcctgtggtgg
tttggaatttttaaccctgcaatagtatacgatcacttgggggaaatatactctgctctt
gtatttggaagctttgtgttctgtatttttctgtacataaagggtcatcttgctccatct
tcatctgattctggatcctcagggaatgtgataattgatttctactggggaatggaacta
tatcctcgcattggtaagcactttgatatcaaagtgttcacaaactgccgttttgggatg
atgtcctgggctgttcttgctgtaacctactgcataaagcagtatgaaatgaatggccga
gttgcagattcaatgcttgtgaatactgcattgatgttgatctatgtcaccaagttcttc
tggtgggaatctggatactggtgcactatggacattgctcatgatagagctggtttctac
atttgctggggatgcttggtatgggttccatcaatatacacctctcctggaatgtacctt
gtcaaccaccctgtgaatttgggtccccagctagcactctcaattctccttgctggaata
ttgtgcatatatataaactatgactgtgatcgtcagcgccaagaattccgtcggacaaat
gggaaatgctcaatatggggcaaagctccatctaagattgttgcttcctatcagactaca
aatggagaaacaaaaagcagtcttctcttgacttctggatggtggggcttgtctcgtcat
tttcactatgttccagagattctatctgcttttttctggacagttccagctctttttgat
catttcctgccgtacttctatgtgatctttctgaccatattgctgttcgaccgagctaaa
agggatgatgaccgatgctcatcaaagtatggcaagtattggaagatgtactgcaacaaa
gtaccgtgcagggttattcctggcatttactga

DBGET integrated database retrieval system