KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0525900-01Help
Entry
Os02t0525900-01   CDS       T02163                                 

Gene name
Os02g0525900
Definition
Similar to Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA ligase 2) (Acyl-activating enzyme 2).
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dosa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dosa00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(19219400..19219609,19219965..19220111,19220201..19220356,19220476..19220598,19220679..19220847,19221306..19221388,19221523..19221624,19221710..19221798,19221923..19222013,19222340..19222453,19222977..19223053,19223140..19223218,19223316..19223384,19223628..19223803,19223915..19223971,19224066..19224156,19224250..19224348,19224484..19224669)
AA seq 705 aa AA seqDB search
MGTASGDQPAGASSDKLRHVESMSELPSGAGRISGINAVVLGESLAAEEHDLVYPSAEFS
ADALVPSPKKYQKMYERSINDPAGFWSEIADAFYWKEKWNPSEVCSENLDVTKGPVQISW
FKGGKTNICYNAVDRNVEAGNGDKIAMYWEGNEPGQDGKLTYSELLDRVCQLANYLKSVG
VGKGDAVIIYLPMLLELPIAMLACARIGAVHSVVFAGFSADSLAQRIVDCKPKLVITCNA
VKRGVKPILLKDIVDAGLAESEKQGVAVGLCLTYENQSAMKREDTKWQAGRDVWWQDVVT
SFPTKCDVEWVDAEDPLFLLYTSGSTGKPKGVLHTTGGYMVYSATTFKYAFDYKPSDIYW
CTADCGWITGHSYVTYGPLLNGATVLVFEGTPNYPDSGRCWDIVDKYKVTIFYTAPTLVR
SLMRDGTEYVTRHSRKSLRVLGSVGEPINPSAWRWFYNIVGDSRCPISDTWWQTETGGFM
ITPLPGAWPQKPGSATFPFFGVQPVIVDEKGKEIEGECSGYLCIKKSWPGAFRTLYGDHD
RYETTYFKPFAGYYFTGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPKC
AEAAVVAVEHEVKGQGIYAFVTLVDGVPYSEELRKSLILTVRNQIGAFAAPDKIHWAPGL
PKTRSGKIMRRILRKIASKQLDELGDTSTLADPGVVDQLIALKDC
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggggacggcgagcggggaccagccggcaggggcgtcgtcggacaagctgcggcacgtg
gagtccatgtcggagctgccctccggcgccggcaggatctccgggatcaacgccgtcgtc
ctcggcgagtcactcgccgccgaggagcacgacctcgtctacccctccgccgagttctcc
gccgacgccctcgtcccctcccccaagaagtaccaaaagatgtatgagaggtcaatcaac
gacccggccgggttctggtcggagatcgccgacgccttctactggaaggagaagtggaac
cccagtgaggtctgctccgagaacctcgacgtcaccaaggggcctgtccagatcagttgg
ttcaaaggtggcaaaacaaacatatgttacaatgctgttgatcgcaacgtcgaggctggg
aacggagacaagatcgcgatgtattgggagggcaatgagcctggtcaggatgggaagctc
acctattcagagctcttggacagggtttgccagcttgccaattacttgaagagtgttggt
gtcggcaagggtgatgctgtgatcatctacttaccaatgttgctggagcttcccattgcc
atgcttgcttgtgcccgcattggtgctgttcactcggttgtatttgctggcttttctgcg
gattccctggcccaaaggatcgttgattgcaagcctaagcttgtgatcacttgcaatgca
gtcaaaagaggggtgaagcccatccttctgaaagatatagtggatgctggtctggctgaa
agtgagaaacaaggagtcgctgtaggtctatgtttgacatatgaaaatcagtcagcaatg
aagagagaagacacaaaatggcaagcaggaagggatgtttggtggcaggatgttgtgacc
agtttcccaaccaagtgcgatgtagaatgggtggatgcagaggacccattgttccttctg
tacacaagtggcagtacaggaaagccaaagggtgtgttgcatactactgggggctacatg
gtttacagtgcaacaacatttaagtatgcatttgattacaagccgtcggacatatactgg
tgcactgcagactgtggctggattactggacacagctatgtgacgtatggtccactcctg
aatggagcaacagttctcgtttttgaagggactccaaattaccctgattctggtcggtgc
tgggacattgtggacaagtacaaggtgacaatattttacactgcaccaacactcgttcga
tcactcatgcgtgatggcaccgagtatgttacacgtcactctcgaaaatctcttcgagtc
ttgggaagtgttggtgagccaattaatcctagcgcatggagatggttctacaatattgtc
ggggactctcgatgccctatctccgacacctggtggcagactgaaactggtggcttcatg
atcactcctttacctggcgcctggcctcaaaaaccaggttctgcaacctttcctttcttt
ggtgttcagcctgtcattgttgatgagaaagggaaggagattgaaggagaatgcagtgga
tatctttgcataaagaaatcatggcctggggctttccggactctctatggagatcatgat
agatatgagaccacttacttcaagccatttgctggctactattttactggggatggttgc
agcagggacaaagacggttaccactggctgactggaagagtagatgatgtcatcaatgtc
agtggacaccggattggtacagcagaggttgagtctgcgttggtttcacacccaaagtgt
gcagaggctgctgttgttgctgttgagcatgaagtgaaaggtcaaggaatatatgctttt
gtaactttggtggatggtgttccttatagtgaagaactacggaaaagcctcatattgaca
gtccgcaaccagattggggcatttgcagctcctgacaagatccactgggcaccaggactt
cctaaaacgagaagcggtaagataatgcgcaggattctgcgcaaaattgcctcaaaacag
ctggatgaacttggtgacacaagcacccttgctgatcctggcgtcgttgaccagctgatt
gcgctcaaagattgctag

DBGET integrated database retrieval system