KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0534400-01Help
Entry
Os02t0534400-01   CDS       T02163                                 

Gene name
Os02g0534400
Definition
(RAP-DB) Cell wall invertase (EC 3.2.1.26).
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Os02t0534400-01 (Os02g0534400)
   00500 Starch and sucrose metabolism
    Os02t0534400-01 (Os02g0534400)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os02t0534400-01 (Os02g0534400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
RAP-DB: Os02t0534400-01
Position
chr02:join(19682605..19682791,19683660..19683668,19684304..19685157,19685338..19685496,19685896..19686143,19686443..19686533,19686672..19686857)
AA seq 577 aa AA seqDB search
MGTRLLALAPWLLLLLLQLAGASHVVHRSLEAEQAPSSVPASIVSPLLRTGYHFQPPMNW
INDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLINWIALEPAIKPDIPSDQYG
CWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNASDPLLREWVKPAYNPVATPEP
GMNATQFRDPTTAWYADGHWRMLVGGLKGARLGLAYLYRSRDFKTWVRAKHPLHSALTGM
WECPDFFPLQAPGLQAGLDTSVPSSKYVLKNSLDLTRYDYYTVGIYNKVTERYVPDNPAG
DYHRLRYDYGNFYASKTFFDPVKHRRILLGWANESDSVTYDKAKGWAGIHAIPRKVWLDP
SGKQLLQWPIEELETLRGKSVSVFDKVVKPGEHFQVTGLGTYQADVEVSLEVSGLEKAEA
LDPAFGDDAERLCGAKGADVRGGVVFGLWVLASAGLEEKTAVFFRVFKPAGHGAKPVVLM
CTDPTKSSLSPDLYKPTFAGFVDTDISSGKISLRSLIDRSVVESFGAGGKTCILSRVYPS
MAIGDKAHLYVFNNGEADIKISHLKAWEMKKPLMNGA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgcc
ggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccg
gcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactgg
atcaacgatccgaacgggccactgtattacaagggatggtaccacctattctaccagtac
aaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctc
atcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggt
tgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactggg
atcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtca
gacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcct
ggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattgg
cggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagc
cgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatg
tgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacaca
tctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactac
tacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggc
gactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgac
ccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctac
gacaaggcgaagggctgggccggcatccatgcgatcccaagaaaggtatggctggacccg
agcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcg
gtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcgga
acctaccaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcg
ttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtg
aggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaacc
gccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatg
tgcaccgaccctaccaagtcttctcttagcccggatctctacaagccaacttttgccggg
ttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttgattgaccgttcg
gtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcg
atggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaag
atttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaa

DBGET integrated database retrieval system