KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0550300-00Help
Entry
Os02t0550300-00   CDS       T02163                                 

Gene name
Os02g0550300
Definition
PDIL5-3 - Zea mays protein disulfide isomerase.
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os02t0550300-00 (Os02g0550300)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os02t0550300-00 (Os02g0550300)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Os02t0550300-00 (Os02g0550300)
  Exosomal proteins of colorectal cancer cells
   Os02t0550300-00 (Os02g0550300)
  Exosomal proteins of bladder cancer cells
   Os02t0550300-00 (Os02g0550300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(20700388..20700639,20701108..20701211,20701299..20701672,20701911..20702215,20702459..20702698)
AA seq 424 aa AA seqDB search
MGKPTLPPVVVVVVLLLLVVVLPATTCGADAGGGGEAEEFQIPRDGRVLELDDGNFDAAV
RAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLAGLSTPIVVAKVNADKYKKLGSKYGVDG
FPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDVSVLESDSAIKSFVEDAGMGFPLFL
GFGVDESLIVEYGAKYKNRAWFSVAKDFSEDMMVFYDFDKVPALVSVNPKYREQSIFYGP
FDDAFLEDFIRNSLLPLVVPMNRETVKMLNDDGRKVVLMILQDDESDENSPRLIKVLRSA
ASANRDLVFGYVGVNQWEEFTETFDVKSSELPTMIVWDKKEEYEIVEGSERLEEGDYGSQ
ISRFLEGYRAGRTIKKKVGDRSPTLLGVNAVYILVFLVAVLVLLMYFSGQGEEDQRPRQR
AHED
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagccgacgctgccacccgtcgttgtcgtcgtcgtcctcctcctcctcgtcgtc
gtgctgccggcgacgacttgcggggcggacgcgggcggcggaggggaggcggaggagttc
cagatcccccgggacgggagggtgctggagctggacgacggcaacttcgacgcggcggtt
cgcgccgccggcctcctcttcgtcgacttctacgcgccatggtgcggccactgcaagcgc
ctcgcccctcagttagatgaagctgctccggtgctggctggattgagcacacccatcgta
gttgctaaggtgaatgccgacaaatacaaaaagctcggatcaaaatatggagtagatggg
ttccccactctgatgctctttgaccacggaaccccaacagagtacactggttcaaggaag
gccgatttgctcgttgagaaccttaagaagcttgttgcgcctgatgtttctgttctcgaa
tcggactcagcgatcaaaagcttcgttgaggatgctggcatgggttttccattgtttctc
gggtttggggtggatgaatccttgattgttgagtatggagcgaagtacaagaacagggcc
tggttttctgtagcaaaggatttctctgaagatatgatggtcttttatgatttcgacaag
gtccctgcattggtttctgttaacccaaagtatcgtgagcagagcattttctatggccct
tttgatgatgccttcttggaagattttatacggaattcccttctgcctttagttgtgccc
atgaacagagagactgtcaagatgttgaatgatgatgggaggaaagtagttcttatgatt
ttacaggatgatgaatccgatgaaaattccccacggctgataaaagtattgaggtctgca
gccagtgcaaaccgtgatctagtgtttggttatgtaggagtcaaccagtgggaggaattc
actgagacttttgatgttaagagctcagagctgccaacgatgatagtctgggacaaaaaa
gaggagtatgaaatagttgagggttcagaaaggcttgaagaaggtgactatgggtcccag
attagccgtttccttgagggatacagggcaggaagaacaataaagaagaaagtgggcgat
cgatccccgaccctgcttggtgtgaatgcggtgtacattctcgtctttctggttgctgtt
cttgttcttctcatgtatttctctgggcaaggcgaggaagatcaacgaccaagacaacga
gcccatgaagattga

DBGET integrated database retrieval system