KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0554900-01Help
Entry
Os02t0554900-01   CDS       T02163                                 

Gene name
Os02g0554900
Definition
Similar to Protein disulfide isomerase (Fragment).
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os02t0554900-01 (Os02g0554900)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os02t0554900-01 (Os02g0554900)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Os02t0554900-01 (Os02g0554900)
  Exosomal proteins of colorectal cancer cells
   Os02t0554900-01 (Os02g0554900)
  Exosomal proteins of bladder cancer cells
   Os02t0554900-01 (Os02g0554900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(20961583..20961899,20961145..20961469,20960433..20960621,20959799..20959924,20959442..20959579,20959191..20959307,20958647..20958764,20958105..20958217,20957583..20957777))
AA seq 545 aa AA seqDB search
MWPRAPATPPPPPWPSKPSAASRSALRRLDLDDGRRQGTEGEENHAPLLCSPAMASSTAF
AAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAA
AAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGI
VAYLKRQAGPASVEIAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVAEKMRADY
DFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGFPTVVTFD
TSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFLIGDVTAS
QGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVKSEPIPEV
NDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVVIAK
MDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPGEATTTES
VKDEL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggccacgagccccggccacgccgccgccgccgccatggccatcaaaacctagtgcc
gcctcgcgcagcgcgctgcgtcgtttggatctcgacgacggccggcgccaaggcacggag
ggagaagaaaaccacgcgcctcttctgtgttctccggcgatggcgagctccacggcattt
gcagcggcatttgcgctgctgctgctagcgtcgtcggcggcggcggagggggaggcggtg
ctgacgctggacgccggcaacttcacggaggtggtgggggcgcacgacttcatcgtcgtc
gagttctacgccccatggtgtggccactgcaaccagcttgctccggagtacgaggcggcc
gccgccgccctgcgctcgcacgacccgccggtcgtcctcgccaaggtcgacgccagcgcc
gacctgaaccggggcctcgccggcgagcacggcgtgcagggctaccccaccatcaggatc
ctccgggaccgcggcgccaggtcgcacaactacgccgggccccgggacgccgccggcatc
gtcgcctacctcaagaggcaggccggcccggcctccgtcgagatcgctgcctccgcctcg
ccgccagcggccgactccatcgccaacgacggcgtggtcgtcgtcggagttttccccgaa
cttagcggcagcgagttcgagagtttcatggcggtggcggagaagatgagggccgactac
gatttccggcacacgacggacgccggcgtcctcccacggggtgatcggacggtgaggggg
cctctcgtccgcctcttcaagcccttcgacgagctcttcgttgactcgcaggattttgat
agagatgcgttggagaagtttatcgagtcttctggtttccctacagtggttacctttgac
actagtccggcaaaccagaaataccttctgaaatacttcgacaatgccggcaccaaagcg
atgcttttcctgagcttcagtgatgacagagcagaggaattcagaactcagttccatgaa
gctgcaaatcaatacagcgcaaacaacataagctttctgattggtgatgtcactgcctct
cagggtgctttccagtattttgggcttaaagagagtgaagtgcccctcgttttcatacta
gcatcgaagtcgaagtatatcaaaccaactgtggagcctgatcagatcttgccctacctg
aaggaatttacagaaggaacattggcaccccatgttaaatcagaacccattccggaggtt
aacgatcagcctgttaagaccgttgttgctgacaatcttcgagaggtggttttcaactcc
ggcaaaaacgttctgctcgagttctatgctccatggtgtggacattgtcagaagctggcc
ccgatcttggaagaggttgcagtttcattgaaagatgatgaagacgtcgtcatagcaaag
atggatggtactgccaacgatgtaccgtcagatttcgcggtggaggggtacccaagcatg
tacttctactcgtctggggggaacctcctgccctacgacgggaggacagccgaggagatc
atcgatttcatcaccaagaacaagggctccaggcctggggaagcaaccacgactgaatct
gtcaaggatgaactgtga

DBGET integrated database retrieval system