KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0573400-01Help
Entry
Os02t0573400-01   CDS       T02163                                 

Gene name
Os02g0573400
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os02t0573400-01 (Os02g0573400)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os02t0573400-01 (Os02g0573400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(21991083..21991346,21989606..21989722,21988751..21988849,21988129..21988311,21987867..21988048,21987157..21987559))
AA seq 415 aa AA seqDB search
MARTARLLAAEDPPPPPAAAAERPRPAAAGSGLRSLSSAASGLWDRLSVLGAGVSKLEKA
LGDHFPEGARYFGLENFGNTCYCNSVLQALYHCIPFREQLLEYYATYKNTEDSEDNLLTC
LADLFSQITLAKKRTGVLAPKRFVQRVRKQNELFRSYMHQDAHEFWNFLVNDIIDILEED
CRTANSSPETTPEEVSNGAANALANGARERPLVTLVHRTFQGILTNETKCLMCDTITAKD
ETFFDLSIDVEQNSSLTSCLKSFFSTEILNGEDKFFCDKCSSLQEAHKRMKIKKAPHVLV
IHLKRFKYVEQLSRHKKLSYRVVYPLELKLGSMSEDADCEYSLFAVVVHVGSSPNHGHYV
SQIKSHGNWLSFDDDTVQISEESTLQTFYGSSREHCGGNTDHGYILFYERLGGKS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacggcgcggctgctcgcggcggaggacccgccgccgccgccggcggcggcc
gcggagaggccccggccggcggcggcggggtcggggctccggtcgctctccagcgccgcg
tccgggctgtgggaccgcctctcggtcctcggcgcgggcgtctccaagctcgagaaggcc
ctcggcgaccacttccccgagggcgcgcgctacttcggcctcgagaacttcggcaacacc
tgctactgcaacagcgtcctgcaggcactttatcattgcatcccttttcgggagcagttg
ctggaatattatgcaacttacaaaaacacagaagactccgaggacaatttgttgacttgt
ctggctgatcttttttcacagataactctagcgaagaaaaggactggtgttcttgcacca
aaacgttttgttcaaagagtgaggaaacagaatgaattgttcagaagttatatgcaccag
gatgcccatgagttctggaatttcttagtgaatgatattattgatattcttgaagaagat
tgtagaactgcaaatagttctcctgagactactcctgaagaggtctcaaatggggcagcc
aatgctttagcaaatggagccagagaaaggccattagttacattggtgcacaggactttt
cagggtattttgaccaatgaaaccaaatgcctaatgtgtgatactatcacagcaaaagat
gagacgttttttgatttgagcattgacgtggaacagaatagttcgctcacaagctgcctg
aagagcttcttttccactgagattttaaatggcgaggataagttcttttgtgacaaatgc
agcagtttgcaagaagcacacaagagaatgaagataaagaaggcgccacacgtattggtg
atccacctgaagcgcttcaagtacgttgagcagcttagccggcacaagaaactgtcgtac
cgagtggtatatcccctggagctgaagctgggcagcatgtctgaagacgctgactgcgag
tactccctctttgcggttgtagtccatgttgggagcagccccaaccatggacactacgta
agccaaattaaaagccatggtaactggctttctttcgacgatgacaccgtccagatcagc
gaggaatccaccctgcaaacattctatggctcttctcgggagcattgtggtggcaacaca
gatcatggctatatcttgttctatgagcgccttggtgggaagagctag

DBGET integrated database retrieval system