KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0592200-01Help
Entry
Os02t0592200-01   CDS       T02163                                 

Gene name
Os02g0592200
Definition
Similar to alkaline phosphatase D.
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Os02t0592200-01 (Os02g0592200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Os02t0592200-01 (Os02g0592200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(22915464..22915607,22915140..22915367,22914581..22914702,22914276..22914336,22913561..22913701,22913034..22913141,22912153..22912381,22911748..22911996,22911355..22911437))
AA seq 454 aa AA seqDB search
MATSTRALLLLPLLLLFLLSRSLSLRADPGAAVSRIAFGSCANQSAPQPVWEAVVGFDPQ
VFIWLGDNVYGDNKRPFRVFGRERTVGPWRNVPRFYPSTEAELRRRYEMAKAKPGYAKLR
ERAQVIGTWDDHDYGLNDAGKEFGGKVTSQRLLLDFLDEAEDSSRRQQAGVYASYMFGPE
GKRVKVILLDTRYHRDPLSSDGAVLGDPQWQWLERELHGPRSEITIIGSSIQVISNLSAT
TGPLFYVESWARFPRERERLFRLIDSSKRNGVFFISGDVHFGEISRYDCGAQYPLYDITS
SGLTQSVENSVPSVFQPLMRLVALLTPTTLRVFSPNCRYKSCTYGQPNFGAIEIDWNAVP
PQIKLELRDVEGNSVGGVEFPISELDPSKAHAITKQGHSYQRHCALETELPWLVWHRLAL
LLFGTIAVLVIAVVLLGITCLSAANIFTKKSKME
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctccacgcgggcgttgctcctcctccccctcctcctcctcttcctcctctcc
cgctccctctccctccgcgccgatcccggcgccgccgtgtccaggatcgccttcggctcc
tgcgccaaccagagcgcgccccagcccgtgtgggaggccgtcgtggggttcgacccgcag
gtgttcatctggctcggggacaacgtgtacggcgacaacaagaggccgttccgggtgttc
gggagggagaggacggtggggccgtggaggaacgtgccgcggttctacccgtcgacggag
gccgagctgcggaggcgctacgagatggccaaggccaagcccgggtacgccaagctcagg
gagagggctcaggttattggaacatgggatgatcacgattatggactgaatgatgcagga
aaagagtttggtgggaaggtgacctctcaaaggcttctattagattttctggatgaagct
gaagatagttcacggaggcagcaagctggtgtttatgcctcctacatgtttggccctgaa
ggaaaacgggtaaaggtaattctgttggacaccagatatcacagagaccctctatcaagt
gatggagctgtactgggagatcctcagtggcaatggctggagagggaactgcatggtcct
cgatcagagatcaccatcattggatcttcaatacaagtaatatcaaatctatctgccacc
actggacctttgttctatgtggagtcatgggcacgctttccaagggaaagagaacgactg
ttcagactgatcgatagcagtaagagaaatggagtgttttttatcagcggtgatgttcat
tttggagaaatttctcgttatgactgtggagctcaatatccattgtatgatattacctca
agtggtcttacccaatctgttgagaattccgtgccatcagtatttcaaccacttatgaga
cttgtggctttgttgacaccaactaccttgcgagtctttagccctaactgtcgttacaaa
tcatgcacatatggtcaaccaaactttggagcaatcgaaatagattggaatgcagtgcct
ccccagattaaactcgaactaagagatgtagagggaaactctgttggtggtgtggagttt
cctatatctgaactggatccatcaaaagcacatgccattacaaaacaagggcattcgtac
caacggcattgcgctctcgaaacagagcttccatggctagtgtggcaccgtcttgctctg
ttgttgtttggtacaattgctgttcttgtcatagccgtggtgttgctaggaattacctgc
ttatcagctgctaatattttcaccaagaaatccaagatggaatag

DBGET integrated database retrieval system