KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0654500-01Help
Entry
Os02t0654500-01   CDS       T02163                                 

Gene name
Os02g0654500
Definition
Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 family protein.
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os02t0654500-01 (Os02g0654500)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Os02t0654500-01 (Os02g0654500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(26404971..26405021,26405166..26405297,26405395..26405448,26407296..26407401,26407967..26408025,26408111..26408185,26408619..26408667,26408760..26408836,26409169..26409255)
AA seq 229 aa AA seqDB search
MGKRWIPLEANPDVMNQFMWGLGVAEGEAQFCDVYGLDDELLAMVPQPVLAVLFLYPLTS
LDDDEEESGAAATSTAGDKDLSKRVYFTKQTVGNACGTVGVIHAIGNAASKLKLVEGSYF
DRFYKQTVDMDPVQRAAFLEEDDEMEDAHSVAASAGDTDANVEVNEHFVCFSCVDGELYE
LDGRKSQPICHGPSSPDTLLQDAAKVIKARIASNPDSMNFNVMALSKVV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcggtggatccctctcgaggccaaccccgacgtcatgaaccagttcatgtgg
gggctgggagtcgccgagggggaggcgcagttctgcgacgtctacggcctcgacgacgag
ctgctcgccatggtgccccagcccgtgctcgccgtcctcttcctctacccgctcacttcc
ctggacgacgacgaggaggaatcaggcgctgctgccacttccacggctggggacaaggat
ttgagcaagagggtatactttacaaagcagactgttggcaacgcatgcggaacagttggt
gttatccatgcaatagggaatgctgcatccaaactcaagctggttgagggatcctatttt
gatagattttataaacaaactgttgatatggatccagtccagcgtgctgcctttcttgag
gaggatgatgagatggaggatgctcattccgttgctgcttcggctggcgacactgatgct
aatgttgaggtgaacgagcactttgtatgtttctcttgtgttgatggtgaactttatgag
cttgatggacgaaaatcgcaaccaatatgtcatggcccttcatcaccagatactttgtta
caggatgctgcaaaagtcatcaaagccagaattgcgtccaaccctgactcaatgaacttc
aacgtcatggctctttcgaaagttgtgtaa

DBGET integrated database retrieval system