KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0664000-01Help
Entry
Os02t0664000-01   CDS       T02163                                 

Gene name
Os02g0664000
Definition
Similar to Phospholipid hydroperoxide glutathione peroxidase, chloroplast precursor (EC 1.11.1.12) (PHGPx).
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dosa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dosa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(26929770..26930027,26930338..26930414,26931104..26931165,26931304..26931422,26931833..26932000,26932094..26932126)
AA seq 238 aa AA seqDB search
MPSRTAPFISRLRLLRTAAALSPFSSSAPPRHSPRILRAIPVGAPHPPRVSAAVSPLVRP
VAAGFALFSMATAASSAASVHDFTVKDASGKDVDLSTFKGKVLLIVNVASQCGLTNSNYT
ELSQLYEKYKDQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNT
APIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEKDIKKLLGSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcgcaccgccccgttcatctctcgcctccggctcctccgaaccgccgccgcc
ctctccccgttctcgtcctccgcgccgccgcggcacagcccccgcatcctccgcgctatc
cctgtcggtgcgcctcacccgccgcgcgtctccgcagccgtctcgccgctggtccgtccg
gtcgccgccgggttcgcgctgttcagcatggccaccgccgcctcctccgccgcatccgtc
cacgacttcaccgtcaaggatgcaagtggcaaagatgtggacctgagcaccttcaagggg
aaagtcctccttatcgtcaatgttgcatctcagtgtggcttgaccaattccaactacacg
gagctgagccagttgtatgagaagtacaaggaccagggttttgagatccttgctttccca
tgcaaccagtttggtggacaggaacctggcactaatgaggagattgtccaatttgcttgc
acccgcttcaaggccgagtatccaatttttgataaggttgatgttaatggtgacaacact
gcacccatctacaagtttctgaagtccagcaaaggtggtcttttcggtgacaatatcaaa
tggaacttctccaagttcttggtcgacaaagaggggcgtgttgtggagcgctatgcgcca
actacttctccactcagcatggagaaggacatcaagaagctgcttggaagttcttaa

DBGET integrated database retrieval system