KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0693400-01Help
Entry
Os02t0693400-01   CDS       T02163                                 

Gene name
Os02g0693400
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:join(28472825..28472881,28473538..28473621,28473756..28473815,28473905..28473979,28474590..28474664,28474839..28474916,28475197..28475274,28475368..28475488,28475591..28475736)
AA seq 257 aa AA seqDB search
MADQNGAAAVSEAEAAPVQVETGAESGDAESEQYQPFFSMCQPIRSVSYSNSWDMVCAPT
IKSNEHNSNLDSMDDKYMLSAPWPENEQPQSENDMDLLDGDTNMQSEPLSTEQPSSNDEI
DIWDGKTKQDSSSLLDSKLCNSGSGAEPCNMEGQQFSLSFSRNTQSQLVGSGLGNMGNTC
FLNSILQCVTHTVPLFLRLRSTDHCAPCSYDKDGFCSFCALKEHIDESIRRSGSVIRPVR
FRDNLRSILCSRFFLAV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagaacggcgccgcggccgtgagcgaagcggaggccgcccctgttcaggtt
gaaactggtgctgaaagtggggatgctgaaagtgagcagtaccaaccatttttctccatg
tgccagccgattcgctctgttagctattcaaattcctgggatatggtttgtgcccccaca
attaagagtaacgaacacaatagcaacttggattcgatggatgataaatacatgctgagt
gcaccttggcctgaaaatgagcagccccagtctgagaatgacatggatttgttagatggg
gatacaaatatgcagtctgaacccctcagcacagagcagcctagctccaatgatgaaata
gatatctgggatgggaaaactaagcaagactcatcatcccttcttgacagcaagctgtgc
aactccggcagcggcgctgaaccttgcaacatggagggccaacaattttctttgtccttt
tcccgcaacactcaatctcaattggtgggatctggtcttggcaatatggggaacacatgc
ttcctaaactcaattcttcagtgtgtcacccatacagtcccactttttctcaggcttcgt
tccactgatcactgtgctccatgctcatatgataaagatggtttctgttcattctgtgct
cttaaagaacatattgatgaatcaatccgaaggtctggatctgttataaggccagtgagg
ttcagagataatttaaggagtatcctttgctctcgatttttccttgcagtttaa

DBGET integrated database retrieval system