KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0751800-01Help
Entry
Os02t0751800-01   CDS       T02163                                 

Gene name
Os02g0751800
Definition
Phosphoglycerate mutase 1 family protein.
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os02t0751800-01 (Os02g0751800)
   01230 Biosynthesis of amino acids
    Os02t0751800-01 (Os02g0751800)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os02t0751800-01 (Os02g0751800)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os02t0751800-01 (Os02g0751800)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Os02t0751800-01 (Os02g0751800)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Os02t0751800-01 (Os02g0751800)
  Exosomal proteins of melanoma cells
   Os02t0751800-01 (Os02g0751800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:join(31598151..31598382,31598487..31598710,31598815..31598933,31599035..31599191,31599435..31599536,31599618..31599737,31600127..31600171)
AA seq 332 aa AA seqDB search
MAASTSQHALVSVKSLCTGANFGFEKRTSKVRFVLVGRCCSGTRKLGLVCASNSHSSVME
PAQLPLSPESGNTPKKSSESALILIRHGESLWNEKNLFTGCVDVPLTPKGVDEAIEAGKR
ICNIPVDVIYTSSLIRAQMTAMLAMMQHRRKKVPIVVHSESEQAHRWSKIYSEETKKQSI
PVITAWQLNERMYGELQGLNKQETADRFGKEQVHEWRRSYDIPPPNGESLEMCAERAVAY
FKDQIVPQLVAGKHVMIAAHGNSLRSIIMHLDKLTSQEVISLELSTGIPMLYIFKEGKFI
RRGSPAGPSEAGVYAYTRSLAQYRQKLDNMFQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccacgtcccagcatgcgctcgtatccgtcaagtcgttgtgcaccggtgcc
aactttggtttcgaaaagagaaccagcaaagtgcgttttgttttggttgggaggtgctgc
tcgggcacccggaaattgggtttggtatgcgcttcaaactcacattcttcggtgatggag
ccggctcagctaccattgagccccgagagcggaaacaccccaaagaaatcaagtgaaagt
gcgctcatattgatccggcatggtgaatcgctatggaatgagaaaaatctatttactggc
tgcgtcgatgtgcccctgaccccaaagggtgttgacgaggcaattgaggcgggtaaaagg
atatgcaatatcccagttgatgtaatatacacctcgtcactaattcgtgctcagatgacc
gctatgcttgccatgatgcagcatcgtcgtaagaaggttccaattgttgtgcacagtgag
agcgaacaagctcacaggtggagcaagatatacagtgaagagacaaagaagcaatcaatt
cctgtcataacagcttggcagctgaatgaacgaatgtatggggaactacaaggccttaac
aagcaagaaactgctgatcgttttggcaaagaacaagttcatgaatggcgtcgcagttac
gacattcctcccccaaatggcgagagcctagagatgtgtgcagagagagcagttgcttat
tttaaagatcaaattgtacctcagcttgtggcaggaaagcatgtgatgattgctgcccat
ggcaattcacttcgttcaattataatgcacttagacaagttgacttctcaagaggttatc
agccttgaactgtctactggcattcctatgctgtatatatttaaggaaggaaaatttatt
agacgggggagtccggcaggcccttctgaggcaggtgtctatgcctacaccaggagcttg
gctcagtacagacagaagcttgacaacatgtttcagtaa

DBGET integrated database retrieval system