KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0778600-01Help
Entry
Os02t0778600-01   CDS       T02163                                 

Gene name
Os02g0778600
Definition
Similar to CEL5%3DCELLULASE 5 (Fragment).
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os02t0778600-01 (Os02g0778600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Os02t0778600-01 (Os02g0778600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:join(32962047..32962295,32962380..32962790,32962890..32962967,32963058..32963825)
AA seq 501 aa AA seqDB search
MKPRSSRDGHNAAAAAALLLAALVLSGDVLPAVVAGGAPSFNYKDALTKSIMFLEAQRSG
KLPPTNRIKWRGDSGMEDGKLANVDLTGGYYDAGDNVKYGLPLAFTVTTLAWTAMAFEKE
LKAARELENVHAAIRWGTDYFLKAATKKDHLWVQVGDPNADHQCWVRPENMPTPRTLYQI
NDKTPGSEIAAETAAAMTASSMVFRKDKPYSRRLLNKAKLLFQFAKTHQGTYDGECPFYC
SYSGYNDELLWAATWLYLATKRQVYADFIGHEAISSSVAEFSWDLKFPGAQVLLAELNMT
SSGGLQSFKSQADNFVCAVLPDTPFHQVSITPGGMIHLRDGANSQYVTSTAFLFVAYSDI
LRRINQPVMCGAQAVQPARLLQFAKQQIDYLLGANPRGRSYVVGFGVNPPTQPHHRGAST
PVLPPGYQVNCGMSFSEWFTPDRPNPNELTGAIMGGPDGGDNFSDKRGNSSCTEPCTYIN
SLSIGPLAALAIRGPNLIATQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccgctcctcgcgcgacggccataatgccgccgccgccgccgcgctcctcctc
gcggcgctggtcctctccggcgacgtcctgccggcggtcgtggccggtggcgccccctcg
ttcaactacaaggacgcgctcaccaagtccatcatgttcctcgaggcgcagcgctccggc
aagctgccgcccaccaaccgcatcaagtggcgcggcgactccggcatggaagacggcaag
ctcgccaacgtggacctgactggcgggtactacgacgccggcgacaacgtgaagtacggg
ctgccgctggcgttcacggtgacgacgctggcgtggacggcgatggcgttcgagaaggag
ctgaaggcggcgagggagctggagaacgtgcacgcggccatcaggtggggcaccgactac
ttcctcaaggcggcgaccaagaaggaccacctgtgggtgcaggtcggcgaccccaacgcc
gaccaccagtgctgggtccgcccggagaacatgcccacgccccgcaccctctaccagatc
aacgacaagacccccggctccgagattgccgccgagaccgccgccgccatgaccgcctcc
tccatggtcttccgcaaggataagccctactcccgccgcctcctcaacaaggccaagctg
ctgttccagttcgccaagacgcaccagggaacctacgacggcgagtgccccttctactgc
tcctactccggctacaacgatgagttgctgtgggcggcgacgtggctgtacctggcgacg
aagaggcaggtgtacgcggacttcatcgggcacgaggcgatctcgtcgagcgtggccgag
ttcagctgggacctcaagttcccgggcgcgcaggtgctcctcgcggagctcaacatgaca
tccagcggcggcctccagagcttcaagtcccaggccgacaacttcgtgtgcgccgtgctc
ccggacaccccgttccaccaggtgtccatcaccccgggcggcatgatccacctccgcgac
ggcgccaactcccagtacgtcaccagcacggccttcctcttcgtcgcctacagcgacatc
ctccgccggatcaaccagccggtgatgtgcggcgcccaggccgtgcagcccgcccgcctc
ctccagttcgccaagcagcagatcgactacctcctcggcgccaacccgcgcggccgctcc
tacgtcgtcggcttcggcgtcaacccgcccacgcagccgcaccaccgcggcgcctccacc
ccggtgctccccccgggctaccaggtcaactgcgggatgagcttcagcgagtggttcacc
cccgaccggcccaaccccaacgagctcaccggcgcgatcatgggcggccccgacggcggc
gacaacttctccgacaagcgtggcaactcgtcctgcaccgagccttgcacgtacatcaac
tccctctccattggccccctcgccgccctcgccatccgtggcccaaacctcatcgccacc
cagtaa

DBGET integrated database retrieval system