KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0787300-01Help
Entry
Os02t0787300-01   CDS       T02163                                 

Gene name
Os02g0787300
Definition
Similar to MAP kinase kinase.
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Os02t0787300-01 (Os02g0787300)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Os02t0787300-01 (Os02g0787300)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Os02t0787300-01 (Os02g0787300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(33442732..33443841)
AA seq 369 aa AA seqDB search
MRPGGPPSLRAGLQQQQQQQPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPS
STSSSGSSSLGGVPTPPNSVGSAPPAPPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYA
LKVLYGNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRR
IASEAFLADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMD
PCNSSVGTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGDW
AALMCAICYSDSPAPPPNASPEFKSFISCCLQKNPARRPSAAQLLQHRFVAGPQQQQQPQ
PQPLAPPPS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcag
ccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgg
gacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcg
tcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtc
ggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcggg
agcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcg
ctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatc
gcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcag
gccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgc
atcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctac
ctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactcc
ggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggac
ccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgac
ctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcatt
ctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgg
gccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcg
ccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcg
gcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcag
ccgcagcccctcgcaccgcctccgtcatga

DBGET integrated database retrieval system