KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0795000-01Help
Entry
Os02t0795000-01   CDS       T02163                                 

Gene name
Os02g0795000
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os02t0795000-01 (Os02g0795000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os02t0795000-01 (Os02g0795000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:join(33797483..33797734,33798125..33798239,33798656..33798766,33798874..33799046,33799145..33799471,33799574..33799699,33800322..33801632,33801728..33801889,33802056..33802779,33802865..33802958,33803331..33803493)
AA seq 1185 aa AA seqDB search
MMGEAEEGLMHRRIEFHAARRPPRAVEGAGGRFWVEILSPDADKAAVVAAARSEGLVRGL
EKGEGSGGGIDPELRVARMYLRRIGAGLQNFGNTCYLNSVLQCLTYTEPFVAYLQSGEHM
SSCRTIGFCALCALQRHVNSALQSTGKILRPVHIVRNLRCISRSFRISRQEDAHELMVSL
LESMHKCCLPSGVPSGSPSAYEKSLVHRIFGGLLRSQVRCTTCSHCSNKFDPFLDLSLEI
ANAATLVKALQHFTAEELLDGGEKQYNCEHCRQKVVAKKRFMIEKAPSVLTIHLKRFSPF
NPRHKIDKKVQFQPTLNLKPYVSNPEGMEFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGI
WHNLDDNKVYQVREADVLRQKAYMLFYVRDRTRSSVMYSDNCTVNLSVNKMISEKITCMN
GSIKKDTVETKTLRVPSLVKEDVNLKKQNSENGQSSNISNAPQDQCSKSHSNTEVLEAAA
SPNNDPASTQKASCIRPDTAAVNLPMKTEQTAPDNRREITSPAQADVSVLHNASFNQKLY
EKQLQEHQLETDDALTDSRKDAPAALCTYGVGDGLLGRNGQSSEPHIGPCPAALPIHNGG
EGLLGANGQASEAHSGPCSSAFPIHNGGEGLLGASGQSSEPHTGPCPAALPIHDGGQGLL
GPNGQASEPHTDSCPAAFPIHSGGEGLLGANGQASELHTDPCPAAFPIHSGGEGLLGANG
QASEPHTDPCPAAFPIHSAGEGLLGANGQDSEHRTGPIPAAFPVWNGTGVILEKYGQVSG
PADPFCKPTPTISDTVSIAQIIPTEHAAVSNGTVSSSDDLTGNTEANESSEFVKNYGEQV
MVRDLSAETSGDRANADEQTSMQNNTLEVGKDVAKDTDNVANAEEQVLNHPLAEQVKSEK
QIYPGISTTLICSEDTTQLIDKDTGSGKLNKKMNCKSKRQVKYPAVRMFFGPKQLLLASV
KLHKKRKHKRSKKHHALSVHIESIITDQQTSTSETVFSKIISHKSRGQKRSCASASSEDG
TQLFNKKQHIEGTTNSVPMDNNDTKLASADSNDAKLASAELPSSCTNSLVNQTDSRNNVN
ANERGPWHFNLLTRGLREITVPRWDDTEIKNTKETEILHPRTRSIGYVLDEWDEEYDRGK
RKKIRKPKHGFSGPNPFQETANIRSRQRMRLQSDQTKSGNQPLRI
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggaggcggaggaggggctgatgcacaggaggattgagttccacgcggcgagg
aggccgccgcgtgcggtggagggggcgggagggaggttttgggtggagatcctgagcccg
gatgccgataaggcggcggtggtggcggcggcgaggagcgaggggctggtcagggggttg
gagaagggggagggtagcgggggtgggatcgacccggagcttcgcgtcgcgaggatgtac
ttgcggagaattggagctggcttgcaaaattttggcaatacctgctacctcaactcggtt
ctgcaatgcttgacgtataccgagccgttcgtggcctacttgcagagtggggagcacatg
tcctcatgtcggactatcggattctgtgctttatgtgctcttcaaagacatgtaaattct
gctctacagtcaactgggaagatattgagacctgtgcacattgtcagaaatttaagatgc
atttctcgtagtttccgcatctcaaggcaggaagacgcacatgagctaatggttagcttg
cttgagtccatgcacaaatgttgtttaccttctggtgtaccaagtgggtcgccaagtgct
tatgagaagagcctagttcacagaatatttggtggtctcttaagaagtcaggtgagatgc
acaacttgctcacactgttccaacaaatttgatcctttcctggatctcagccttgaaatt
gccaatgctgctactctggtaaaagcacttcaacactttactgcggaagagctactggat
ggtggggaaaagcagtacaactgcgagcactgcaggcagaaagtagtagccaagaagagg
tttatgattgagaaggctccctctgtgttgacaattcatctaaagcgctttagtcctttc
aaccctcgtcacaagatcgacaaaaaagtgcagtttcaaccaactttaaatttaaagcca
tatgtcagcaatcctgagggtatggagttcaaatacagcctttatggtgttttggttcat
gctggttggaatacacagtcaggtcactattattgctttgttcggacttctagtggcata
tggcacaatcttgatgataacaaggtttaccaagttcgtgaggcagatgtgctgaggcag
aaagcatacatgctattttatgtgcgcgacagaacaaggagctcagtgatgtacagtgat
aattgtactgttaatttatcagtaaataaaatgatctccgagaagatcacatgtatgaat
ggttcaattaaaaaagatacagtggaaacgaaaacactgagagttccctcacttgtcaaa
gaagatgtgaacttgaagaaacagaactcagaaaatggtcaatctagcaatattagcaat
gctccacaggaccagtgttcaaaaagtcatagcaacactgaagtgcttgaagctgcagca
tccccaaacaatgacccagcttcaacacagaaagcttcttgcatacgtccagatacagct
gctgttaacttgcccatgaaaacagagcaaacagctccagacaatcgaagggaaataaca
tctccagcacaagctgatgtttctgttcttcacaatgcaagtttcaatcagaagttgtat
gagaagcagctacaggagcatcaactagaaactgatgatgcacttactgattccaggaaa
gatgcccctgctgccttgtgcacatatggtgttggggatggtttgttggggagaaatggc
cagtcttctgaacctcacataggtccatgccctgctgctcttcctatacacaatggtggt
gaaggattgctgggggcaaatggccaggcatctgaagctcactcaggtccttgctcttct
gcctttcctatacataatggtggcgaaggattgttgggggcaagtggccagtcttctgaa
cctcacacaggtccatgccctgctgctcttcctatacacgatggtggtcaaggattattg
gggccaaatggccaggcttctgaacctcacacagattcttgccctgctgcctttcctata
cacagtggcggtgaaggactgttgggggcaaatggtcaggcttctgaacttcacacagat
ccttgccctgctgcctttcctatacacagtggcggtgaaggattgttgggggcaaatggt
caggcttctgaacctcacacagatccttgccctgctgcctttcctatacacagtgccggt
gaaggattgttgggggcaaatggccaggattctgaacatcgaacaggtccaatccctgct
gcctttcctgtatggaatggcactggtgtaatattggagaaatatggtcaggtttctggg
ccagcagatccattttgcaagccaactcctaccataagtgatacagtgtctattgcacaa
atcatcccaactgagcatgctgctgtttctaatggaacagtatctagtagtgatgattta
actggcaatactgaagctaacgagtcatcagagtttgtaaagaattacggcgaacaagtt
atggtgagggatctttctgcagagacctctggtgatagagcaaatgcagatgagcagact
tcaatgcagaataacacactggaagttggtaaggatgttgcaaaggacactgataatgtg
gcaaatgccgaggagcaggtattgaaccaccccttggccgagcaggtaaaatctgagaag
caaatatatcctggaatttctacaacattgatttgctctgaagacacaacacagttgata
gataaggatacaggcagtggcaaattaaataaaaagatgaattgcaagtcaaagaggcaa
gtgaagtatcctgctgttcgcatgttttttgggcccaaacaactgttactggcatcagta
aaactgcacaagaaaaggaaacacaagagatccaaaaaacaccatgcactttctgtgcac
attgaaagcatcatcactgatcagcagacatcaacatcagaaactgttttctcaaagatc
atatcacataaatcccgtggacagaaacgttcttgtgccagtgcaagttctgaggatggc
actcagctgttcaacaagaaacagcatatcgaaggaaccaccaacagtgttcccatggac
aacaacgatacaaaacttgctagcgctgacagcaacgatgcaaaacttgctagcgccgag
ctaccaagctcatgtacaaactctctggtgaaccagactgattcaagaaacaatgtaaat
gcaaatgagagaggcccctggcattttaatctcctcacaaggggtttaagagaaattact
gtgccacgttgggatgacactgagattaaaaatacgaaggaaacagagatactacatcca
aggactagaagcatcggctatgtgctagatgaatgggacgaggagtatgatcgcggcaag
agaaagaagatcaggaaaccaaagcatggcttcagtgggccgaaccctttccaggagacg
gccaacatcagatcacggcagaggatgagactacagtctgaccagaccaaatctgggaac
cagcctctcaggatataa

DBGET integrated database retrieval system