KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0802400-01Help
Entry
Os02t0802400-01   CDS       T02163                                 

Gene name
Os02g0802400
Definition
Similar to calcineurin subunit B.
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Os02t0802400-01 (Os02g0802400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(34209578..34209647,34209350..34209474,34208524..34208620,34208296..34208405,34207505..34207579,34207300..34207350))
AA seq 175 aa AA seqDB search
MGNASSMLTQYDIEEVQEHCNYLFSQQEIVSLYERFCQLDRSAKGFISEDEFLSIPEFSL
NPLSKRLLRMVDGLNFKDFVSFLSTFSAKASVQQKIELIFKVYDIDGKGKVTFKDLVEVL
RDQTGSFMTEEQRERVITNVLEEAGYTRDCTLSLEDFTRIIDHPGLKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcgtcgtcgatgctcacccagtacgacatcgaggaggtgcaggagcactgc
aactacctcttctcgcagcaggagatcgtgtcgctgtacgagcgattctgccagctggat
cggagcgccaaggggttcatctccgaggacgagttcctctccatcccggagttctccctc
aacccgctctccaagaggttgctgcgtatggttgatgggctgaacttcaaggattttgtt
tccttcctctctaccttcagtgcaaaggccagcgttcagcaaaagattgagttgatattc
aaggtgtatgacattgatggcaaggggaaggtaaccttcaaagacctggtagaggttttg
cgggaccaaacagggtcattcatgacagaggaacaaagagagcgagtaataacaaatgta
ctggaagaagctggatacacaagggattgcacgctttctttggaagattttaccaggatt
atagatcatcctggcctaaagatggaggtggaagtgcctattgactag

DBGET integrated database retrieval system