KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0805500-01Help
Entry
Os02t0805500-01   CDS       T02163                                 

Gene name
Os02g0805500
Definition
Similar to PAP-specific phosphatase HAL2-like (3'(2'),5'-bisphosphate nucleotidase) (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')- phosphohydrolase) (DPNPase) (Halotolerance protein).
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Os02t0805500-01 (Os02g0805500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Os02t0805500-01 (Os02g0805500)
Transfer RNA biogenesis [BR:dosa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Os02t0805500-01 (Os02g0805500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr02:complement(join(34365315..34365534,34364986..34365210,34363688..34364372,34363082..34363385))
AA seq 477 aa AA seqDB search
RCRLTKKVEHEEEAAEEEEHLATTGSIHPPIHRRRRRRRRRRGLRASPPWDAAASASPPG
RRPRRRRRRTGTGGSPRVGTAEHDWLWDCRGIGGGGRDYAREMEVAVRVVQAACTLCQRV
QSSLLLPASASASGSVHSKIDRSPVTVADWGVQAIVSWLLSDCFQDENISIVAEEDDETL
SSSDGAALLESVVAAVNGCLIEAPKYGLRSPEKELKAHDILQAIRRCSSIGGPKGRFWVL
DPVDGTLGFVRGDQYAVALALIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKVSPP
TSGSWHKGCVMYAHRGCGQAWMQPLVHDFGKLDWRNSREVRVSTVSDPISATFCEPVEKA
NTSHSFTAGLAHSVGLRKQPLRVYSMVKYAAIARGDVEIFMKFARAGYKEKIWDHAAGVV
IIREAGGVITDAGGRPLDFSRGVFLEGLDRGIIACSGPLLHHRIVGAVDASWNSSTL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
cgttgccggctaaccaaaaaagtggaacacgaagaagaagcagcagaagaggaggagcat
ctcgcaaccaccggatcgattcatccaccaatccatcgccgccgccgccgccgacgacga
cgacgagggcttcgggcttcaccgccatgggatgcagcggcctccgcctccccacctggg
cggcggccgcgccgccgtcgccgtcggactgggacgggcgggtcaccccgggtcgggacc
gcggagcacgactggctgtgggattgccgcggcatcggcgggggcgggagggactacgct
agggagatggaggtcgcggtgcgcgtcgtgcaggccgcctgcaccctctgccagcgcgtg
cagagctcgctcctcctccccgcctccgcctccgcctccggcagcgtccactccaagatc
gaccgctcccccgtcaccgtcgcagattggggcgtccaagcgatagtaagctggctactc
tcggattgctttcaagatgaaaacatatctatagtagccgaagaagatgatgagacgcta
tctagtagcgatggtgcagctttgcttgaatctgtcgttgctgctgtcaatggttgcttg
attgaagctccgaagtatgggctgaggtccccagagaaagagctcaaagctcatgatatt
cttcaagctattaggaggtgcagctctatcggaggtccaaaaggaaggttttgggtgctt
gatcctgtggatggcacgcttgggtttgtacgtggggaccaatacgctgttgctctcgcg
ctaattgaagatggggaagttgtattgggagttcttgggtgcccaaattatccaatgaag
aaggagtggctcaactaccaccaacgatattacaggttgatgtctaaggtttctcctccc
acatcaggatcctggcataagggttgtgtgatgtatgctcaccgaggatgtggccaagct
tggatgcaaccattagttcatgactttggcaagcttgattggcgtaattcaagagaggtc
cgagtatcaactgttagtgatccaatctcagcaacattctgtgaacccgttgagaaagct
aatacaagtcattccttcactgctggacttgctcatagtgtaggcttaaggaagcaaccc
ctgcgtgtgtacagcatggtgaaatatgccgcaatagcacgaggggatgtagaaatattc
atgaaattcgctagagctggatacaaggagaagatatgggatcatgccgctggggtggtt
atcattcgagaagctggcggagtgatcacagatgctgggggccgcccactcgacttctcc
aggggtgttttcttagagggcttggatagaggcataatagcctgttccggaccattgctt
catcacagaattgtgggtgctgtcgatgcaagctggaactcatcaacactgtaa

DBGET integrated database retrieval system