KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0829100-01Help
Entry
Os02t0829100-01   CDS       T02163                                 

Gene name
Os02g0829100
Definition
Replication protein A 30kDa.
Orthology
K10739  
replication factor A2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Os02t0829100-01 (Os02g0829100)
   03420 Nucleotide excision repair
    Os02t0829100-01 (Os02g0829100)
   03430 Mismatch repair
    Os02t0829100-01 (Os02g0829100)
   03440 Homologous recombination
    Os02t0829100-01 (Os02g0829100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr02:complement(join(35642347..35642436,35642135..35642254,35641942..35642039,35641496..35641537,35641282..35641359,35641122..35641200,35640901..35640996,35640738..35640820,35640304..35640372,35640106..35640190))
AA seq 279 aa AA seqDB search
MMSFSQPDAFSPSQFTSSQNAAADSTTPSKSRGASSTMPLTVKQISEAQQSGITGEKGAP
FVVDGVETANVRLVGLVSGKTERNTDVSFTIDDGTGRLDFIRWVNDGADSAETAAVQNGM
YVSVIGSLKGLQERKRATAFAIRPVTDYNEVTLHFIQCVRMHLENTKSQIGSPAKTYSAM
GSSSSNGFSEMTTPTSVKSNPAPVLSVTNGSKTDLNTEVLNVFREPANVESEHGVHIDEI
VKRFRLPEAKIKVAIDYLADIGHIYSTIDESHYKSAFNE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccttcagccagcccgacgccttctcgccgtcgcagttcacctcctcccagaat
gccgccgccgactctaccaccccttccaagagccggggcgcatcgagcaccatgccgctc
accgtgaagcagatctctgaagcgcagcaatctggcatcaccggggagaagggcgctccc
ttcgtcgtcgacggcgtcgagacagccaacgttaggcttgtgggattggtcagtggcaag
acggagcggaacaccgatgtgtccttcacgatcgacgatggcaccggccgcctcgatttc
atcagatgggtcaatgatggtgctgattctgctgaaaccgctgctgttcagaatggaatg
tatgtttctgtcattggtagcctcaaggggcttcaggagaggaagcgtgctactgctttc
gctatcaggcctgtaactgattataatgaggtcacactgcatttcattcagtgcgtgcga
atgcatttagagaacaccaaatcacagattggtagccctgcaaaaacatattctgccatg
ggatcctcatcttccaatggcttcagtgaaatgaccactccgacctctgtgaaatccaac
ccggcaccagtgctcagtgtaacaaatggatcaaaaactgatttgaacacagaagtgctg
aatgttttccgcgaaccagcaaacgtcgagagcgagcatggtgtgcacattgatgaaatc
gtgaagcgcttcaggctaccggaggccaagatcaaggtagctattgattacctcgctgac
attgggcacatatactcaacaatcgacgagtctcactacaagtcagcgttcaatgaataa

DBGET integrated database retrieval system