KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0101100-01Help
Entry
Os03t0101100-01   CDS       T02163                                 

Gene name
Os03g0101100
Definition
Similar to Palmitoyl-protein thioesterase-like.
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Os03t0101100-01 (Os03g0101100)
  Lipid metabolism
   00062 Fatty acid elongation
    Os03t0101100-01 (Os03g0101100)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Os03t0101100-01 (Os03g0101100)
Lipid biosynthesis proteins [BR:dosa01004]
 Fatty acid synthase
  Component type
   Os03t0101100-01 (Os03g0101100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(106608..106701,106818..106878,107028..107079,107207..107227,107315..107368,107793..107843,108001..108063,108701..108766,108843..108881,109146..109268,109904..109996,110090..110314)
AA seq 313 aa AA seqDB search
MAAYSLVFVFVGVAVFVLAPPASAVPFIVLHGIGDQCANHGVAKFTRLLADCEIGSGTWD
SWLMPLQKQADIVCSKVKEMKELSNGYNIVGLSQGNLIGRAVVEFCDDGPPVKNFISLGG
PHAGTASVPLCGSGIFCILADSLIKMEIYSDYVQAHLAPSGYMKIPTDISDYLKGCRFLP
KLNNELPGERNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGGFDPVLPPQKT
KLYMEDWIGLKTLDDEGRVKFVSVPGGHLGISKTDMMKYIVPYLKGKDNGKAWIAATWRA
ITNTIGGEAFVLN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttattccctcgtcttcgtcttcgtcggcgtcgccgtcttcgtcctcgcgcca
ccagcctccgccgtgcccttcatcgtcctgcacgggatcggagaccagtgcgccaaccat
ggtgtcgccaagttcacccgccttctcgccgactgtgaaatcggaagtggaacatgggac
tcttggttaatgcctcttcagaaacaggctgatattgtttgcagtaaggtaaaagaaatg
aaggaactctccaatggttacaatatagttggtctttcacaggggaacctgattggtcga
gcagttgttgagttttgtgatgatgggccaccggtcaagaatttcatttcactcggtggc
cctcatgctggtactgcttcagtgccactttgtggttctggtattttttgcattcttgct
gattccctgattaaaatggagatctactcagactatgtccaggcacatcttgcacctagt
ggttacatgaaaatcccaactgatatttcagattatttaaagggttgtagatttcttcca
aagcttaacaatgagttaccaggtgaaagaaatgccacctacaaggaaaggtttagcagc
ttagagaatttggtattaatcatgtttcaggatgacgctgtcttgatacctcgggaaaca
gcatggtttggttactatccagatggaggtttcgatcctgtcctgccccctcagaagaca
aagctgtacatggaggactggattggtctcaagacgctggatgatgaggggagagtgaaa
ttcgtgtccgtgccaggggggcacctgggtatttccaagactgacatgatgaagtacatc
gtgccctacttgaagggaaaggacaatggaaaggcttggattgctgcgacttggcgtgcc
atcaccaacaccatcggtggggaagcgtttgtgctcaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system